KEGG   Serratia plymuthica 4Rx13: SOD_c47000Help
Entry
SOD_c47000        CDS       T02710                                 

Gene name
rbsK
Definition
(GenBank) ribokinase RbsK
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:srl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SOD_c47000 (rbsK)
Enzymes [BR:srl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SOD_c47000 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase CdAMP_rec
Motif
Other DBs
NCBI-ProteinID: AGO57632
UniProt: S0AM84
Position
complement(5282969..5283922)
Genome map
AA seq 317 aa AA seqDB search
MARNSGINAMETGKLVVLGSINADHILNIEQFPRPGETVIGKQYKVAFGGKGANQAVAAG
RSGADIAFIACVGADDIGERIRLQLATDRIDTQPIEAIADNTTGVALIFVNAEGENVIGI
DAGANAAVTPDYLARYQQRVIEADALLMQLESPLETVMAAARLAKQHQTQVILNPAPARE
LPDELLALVDMITPNETEAQRLTGIAIANDDDAARAAKALHDQGIGTVIITLGSRGVWLS
ENGNGKLVPGFKVKAVDTIAAGDTFNGALVTALLEGKTMADAVRFAHAAAAIAVTRPGAQ
PSVPWREEIDAFLQQQE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaattcaggaatcaatgcgatggaaacaggtaagctggtggtgcttggcagt
atcaatgccgaccatatcctcaatattgagcagtttccccgcccgggcgaaacggtgatc
gggaaacagtataaggtggcatttggcggtaaaggcgcgaatcaggcggtggcggccggg
cgcagcggtgcagatatcgcttttatcgcctgcgtcggcgcagatgacatcggtgaacgc
atccgcctgcaattggcgaccgatcgcattgatacccaacctattgaggcgattgccgac
aacaccacgggtgtggcgctgatttttgtcaatgctgaaggcgagaacgtgatcggcatc
gatgccggcgccaatgccgccgtaacgcccgactatctggcgcgttatcagcagcgggtt
attgaagccgatgctttgctgatgcagctcgagtcgccgctggaaacggtgatggcagcc
gcccgtctggcgaagcagcatcaaactcaggtgatcctcaatccggcgccggcgcgggaa
ctgccggacgagttgctggcgttggtcgatatgattacgcccaatgaaacagaagcccag
cgcctcaccggcatagctatcgctaatgatgatgacgcggcgcgtgcggcgaaagccttg
cacgatcaaggcattggcacggtgatcataactcttggcagccgtggcgtttggttgagt
gagaacggtaacggtaagttggtgcccggtttcaaggttaaagcggtagacaccatcgct
gccggtgataccttcaacggggcgctggtgacggcgctactggaaggtaaaactatggcg
gatgcggtgcgcttcgcccatgcggcggcggcgattgcggtaacccgtcccggcgctcag
ccctccgtaccctggcgtgaagagatcgacgccttcttgcagcagcaggagtaa

DBGET integrated database retrieval system