KEGG   Serratia plymuthica 4Rx13: SOD_c47010Help
Entry
SOD_c47010        CDS       T02710                                 

Gene name
rbsB
Definition
(GenBank) D-ribose-binding periplasmic protein RbsB
  KO
K10439  ribose transport system substrate-binding protein
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl02010  ABC transporters
srl02030  Bacterial chemotaxis
Module
srl_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SOD_c47010 (rbsB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    SOD_c47010 (rbsB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c47010 (rbsB)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    SOD_c47010 (rbsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_6 Peripla_BP_3 ABC_sub_bind ANF_receptor
Motif
Other DBs
NCBI-ProteinID: AGO57633
UniProt: S0AKH8
Position
complement(5283957..5284847)
Genome map
AA seq 296 aa AA seqDB search
MMKMKKLAILASAFALTATLSANALAKDTIALVVSTLNNPFFVSMKEGAQQEANKLGYNL
VVLDSQNNPAKELANVQDLMVQAPKLLLINPTDSDAVGNAIKMANQAKIPVITLDRVASK
GEVVSHIASDNRVGGKMAGDFIAKKVGTDAKVIQLEGIAGTSAARERGEGFKQSLDQNKF
KLLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAGKTDVVVVGF
DGTADGVKAVEGGKLAATVAQRPDQIGVIGVETADKVLKGEKVPATLPVDLKLVTK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgaaaaaactggcaatcctggcttcggccttcgctctgaccgccacctta
agcgctaacgcgttggcgaaagacaccatcgcgctggtggtgtccaccctgaataacccg
ttcttcgtttccatgaaagaaggcgcgcagcaggaagccaacaagttgggttataacctg
gtggtgctggactcgcagaacaacccggcgaaagagctggctaacgtgcaggatctgatg
gtgcaagcgcctaaactgctgctgattaacccaacggattccgatgcggtgggtaacgcc
atcaagatggccaatcaggccaagatcccggtcattacgctggaccgcgtggcaagcaag
ggcgaggtggtcagccatatcgcctcggacaaccgcgttggcggcaaaatggccggcgac
tttatcgctaaaaaagtaggcacagacgctaaagtgatccagctggaagggattgcgggc
acctctgccgcccgtgagcgtggcgaagggttcaaacagtcgcttgatcagaacaaattc
aaactgctggccagccagccggcagatttcgaccgcaccaagggcctgaacgtaatgcaa
aacctgctgactgctcacccggacgtgcaggcagtgtttgcgcagaacgacgaaatggcg
ctgggcgcactgcgcgcgctgcaaaccgccggtaaaaccgatgtggtcgtggtaggcttc
gacggcaccgccgacggcgtgaaagcggttgaaggcggcaagttggcggcgaccgtggcg
cagcgtccggatcaaatcggcgtgattggcgtggaaacggcagataaggtcttgaaaggc
gagaaagtaccggccaccctcccggttgatttgaaactggtcactaaataa

DBGET integrated database retrieval system