KEGG   Serratia plymuthica 4Rx13: SOD_c47040Help
Entry
SOD_c47040        CDS       T02710                                 

Gene name
rbsD
Definition
(GenBank) D-ribose pyranase RbsD
  KO
K06726  D-ribose pyranase [EC:5.4.99.62]
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:srl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SOD_c47040 (rbsD)
Enzymes [BR:srl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.62  D-ribose pyranase
     SOD_c47040 (rbsD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RbsD_FucU
Motif
Other DBs
NCBI-ProteinID: AGO57636
UniProt: S0ALF9
Position
complement(5287353..5287772)
Genome map
AA seq 139 aa AA seqDB search
MKKGVLLNAEVSAVVSRLGHTDQIVICDAGLPIPAVTQRIDLALTQGVPTFLQVVGVVTQ
EMQVESAILAEEMVNQNPQLHQALLAQLIQLGQHQGNTISVSYISHQAFKAQTEHSRAVI
RSGECSPYANVILCAGVTF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggcgtactgctgaatgctgaggtttctgccgtggtttcccggctcggccat
accgatcagattgtcatttgcgatgcagggctgccgatcccggcggtaacgcagcgtatc
gatctggcgctgacccagggagtgccgacgtttttgcaggtggtcggggtagtgacgcag
gagatgcaggttgaaagcgccattctggcggaagagatggtgaaccaaaatccgcagctc
catcaagctttgttggctcaactgatacagcttggccaacaccagggaaacaccattagc
gtgagttatatcagccaccaggcttttaaagcgcaaactgaacacagccgggcggtgatc
cgcagcggtgaatgttcgccgtacgcgaacgtcatcctctgcgccggcgtaactttctga

DBGET integrated database retrieval system