KEGG   Serratia plymuthica 4Rx13: SOD_c47060Help
Entry
SOD_c47060        CDS       T02710                                 

Gene name
ravA
Definition
(GenBank) ATPase RavA
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SOD_c47060 (ravA)
Enzymes [BR:srl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SOD_c47060 (ravA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 DUF3763 Mg_chelatase AAA_3 Sigma54_activat AAA AAA_16
Motif
Other DBs
NCBI-ProteinID: AGO57638
UniProt: S0AKI2
Position
5290030..5291601
Genome map
AA seq 523 aa AA seqDB search
MVVYHRIIHQDWLTLGQHDNNMAPSSLLAERISRLSSALESGLYERQEAIRLCLLAALSG
ESVFLLGPPGIAKSLIARRLKFAFRSARSFEYLMTRFSTPEEVFGPLSIQALKDEGRYQR
LTAGYLPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGNSEEPIPLRLLVTASNELPE
ADNSLEALYDRMLIRLWLDKVQDKQNFRSLLVSRQNENDNPVPEALSISDEEFHQWQSQI
DKVKLPEGCFELIFQLRQRLDALESAPYVSDRRWKKALRLLQACAFFSGRDAVAPLDLML
LKDCLWHDLTSLKLLQQQIDQLLTESAYQQQTLLIQLQQIHTRWLQHQQQQSDRQAIALV
KKGGMFSRKPQYMAAAPLGTGTLTLLLQKPLQLHDIQVNHLSIESSALENWLQKGGDVRA
KLNGIGFAQQIDLEVDEQLHLTVLDVSRQPSLLALPGKQTGGTPQAMLDEMDALAQRLAE
QRRLFSQHQPCLFTPAGGLAKIEASLLQVAEQIKQQHQQMRGQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttatcatcggattatccaccaagattggctaactctcggacaacacgacaat
aatatggcgccatcatcacttctggcagaacggatctcccgcctcagcagcgcgctggag
agcggtctttatgaacggcaggaagcaattcgcctgtgtttactggcggcgctcagcggt
gaaagcgtgtttcttctcggcccgcccggcatcgccaaaagcctgattgcccgccggtta
aaattcgcctttcgcagcgcgcgctcgtttgaatacctgatgacgcgtttctcgacgccg
gaagaagtgttcggcccgctgtctatccaggcattaaaagatgaaggccgctatcagcgt
ctgaccgccggctatctgcccgaggcagagatcgtgttcctggatgaaatctggaaggcc
ggcccggccatcctcaataccctgttaacggcgatcaacgaacgccgcttccgcaacggc
aacagcgaagaaccgatcccgctgcggttactggttaccgcctctaacgaactgcctgag
gccgacaacagtctggaggcgctgtacgaccgcatgctgatccgcctgtggctggacaaa
gttcaggataaacagaatttccgctcactgctggtcagccgccagaacgagaatgacaac
ccggtccctgaagccttgagcatcagcgacgaagagtttcaccagtggcagtcgcagatc
gacaaggtcaagctgcccgaaggctgttttgaactgatattccagttgcgccagcgattg
gatgcgctggagagtgcgccctacgtctccgaccgtcgttggaaaaaggcattgcggctg
ttgcaggcctgcgccttcttcagcggccgcgacgccgtcgccccgctcgacctgatgtta
ttgaaagattgtctgtggcatgacctcacttcgctaaagctgctgcaacagcaaatcgac
caattgctgaccgagtcggcctatcagcagcagacgttgttgattcaactgcaacagatc
cacacccgctggctgcaacaccaacagcagcagagcgatcgtcaggcgatagcgctggtg
aaaaaaggcggtatgttcagcagaaagccccaatacatggcggcggcgccgttaggcacc
ggcaccctgaccctgctgctgcaaaaaccgctgcaactgcatgatattcaagtcaaccat
ctgagcattgaaagcagcgcgctggaaaactggctgcaaaagggcggcgacgtgcgcgcc
aagctgaacggcatcggctttgcccagcagatcgacctggaagtggacgagcagttgcac
ctgacggtgctggacgtcagccgccagccttcgctgctggccctgcccggtaaacagacc
ggcggtacgcctcaggcgatgctggacgaaatggacgcgttggcacagcgtctggcggaa
cagcgccggttgttcagccaacaccagccctgcctgtttacccctgccggtggcctggca
aaaattgaagccagcctgttgcaggtggcggaacagatcaaacagcagcaccagcagatg
cgcggccagtaa

DBGET integrated database retrieval system