KEGG   Serratia plymuthica 4Rx13: SOD_c47090Help
Entry
SOD_c47090        CDS       T02710                                 

Gene name
asnC
Definition
(GenBank) regulatory protein AsnC
  KO
K03718  Lrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srl03000]
    SOD_c47090 (asnC)
Transcription factors [BR:srl03000]
 Prokaryotic Type
  Helix-turn-helix
   Lrp/AsnC family
    SOD_c47090 (asnC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsnC_trans_reg HTH_24 HTH_AsnC-type HTH_20 HTH_11 MarR_2 HTH_5 B-block_TFIIIC HTH_41 HTH_28
Motif
Other DBs
NCBI-ProteinID: AGO57641
UniProt: S0ALG5
Position
5294219..5294680
Genome map
AA seq 153 aa AA seqDB search
MAENYQIDNLDRGILNALMENARTPYAELAKNFAVSPGTIHVRVEKMKQAGIITGARVDV
NPKRLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTGHYSVFIKVMCRSIDAL
QQVLINKIQTIDEIQSTETLISLQNPIMRTITP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaattaccagatcgataatctcgatcgcggcattctcaacgccctgatggag
aatgcgcgcacgccctatgccgaactggcgaagaactttgccgtcagtcccggcaccatc
catgtgcgggtagagaaaatgaagcaggccggtatcatcaccggcgcacgggtagacgtg
aaccccaaacgcctgggttacgacgtctgctgttttatcggcattatattaaagagtgcc
aaagactatccttccgcgcttaaaaaactcgaaagcctggaggaagtggtcgaagcctac
tacaccactggccactacagcgtgtttatcaaagtgatgtgtcgctcgatagatgcattg
caacaagtacttatcaacaagatccagacgattgacgagatccagtccaccgaaaccctg
atctcgctgcagaaccccatcatgcgtaccatcacgccttag

DBGET integrated database retrieval system