KEGG   Serratia plymuthica 4Rx13: SOD_c47160Help
Entry
SOD_c47160        CDS       T02710                                 

Gene name
atpF
Definition
(GenBank) ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
srl  Serratia plymuthica 4Rx13
Pathway
srl00190  Oxidative phosphorylation
srl01100  Metabolic pathways
Module
srl_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:srl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SOD_c47160 (atpF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:srl00194]
    SOD_c47160 (atpF)
Photosynthesis proteins [BR:srl00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SOD_c47160 (atpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_B Mt_ATP-synt_B ESM4 FNIP_C PhdYeFM_antitox V-ATPase_G_2 CRISPR_Cse1 V-ATPase_G
Motif
Other DBs
NCBI-ProteinID: AGO57648
UniProt: S0AKJ0
Position
5300415..5300885
Genome map
AA seq 156 aa AA seqDB search
MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLASAERAKKDLDLAQAN
ATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREEL
RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcttaacgcaacaatcctcggccaggccatcgcgttcgttctgtttgtctggttc
tgcatgaagtatgtatggccgccgattatggctgccatcgagaagcgtcagggagaaatt
gctgacggtctcgcttctgcagagcgtgccaaaaaagatttggacttagcgcaagccaat
gcgaccgaccagctgaaaactgctaaagcagaagctcaggtgatcatcgagcaagcaaac
aaacgcaaagctcagatcatggatgaagcgaaagccgaagccgagcaggaacgtaacaaa
atcgtggcgcaggctcaggctgagatcgaagccgaacgtaagcgcgctcgtgaagagttg
cgtaagcaagtcgcgatgctggcaattgccggcgccgagaagatcatcgaacgttccgtg
gatgaagctgctaacagcgacatcgttgataaactggtcgctgaactgtaa

DBGET integrated database retrieval system