KEGG   Serratia plymuthica 4Rx13: SOD_c47240Help
Entry
SOD_c47240        CDS       T02710                                 

Definition
(GenBank) hypothetical protein
Organism
srl  Serratia plymuthica 4Rx13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMF_TATA_bd IncA CENP-F_leu_zip Spc7 Bap31 BLOC1_2 LETM1 DUF641 KASH_CCD YabB Kinetocho_Slk19 Atg14 Tropomyosin_1 DUF1664 Reo_sigmaC DIM GP41 TMF_DNA_bd bZIP_1 TMPIT
Motif
Other DBs
NCBI-ProteinID: AGO57656
UniProt: S0ALH6
Position
complement(5309475..5309855)
Genome map
AA seq 126 aa AA seqDB search
MKKILILSTVSLGLLAMANATAADGLQRSKQSSGSTDNILLWSHYDQGYIISNYELGDLD
GFKEQLRLQEQVIKKLQDKLSNMENENRNQNSEIDNLKRKLQGQDNAQSEISDLKRSVQD
LNNKIK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatacttatattgtcaacggttagccttggtttgctggctatggccaacgcc
acggcggcggatggactacagcgcagcaagcagtcgagcggcagtaccgataacatcctt
ctttggagccattacgaccaaggctacatcatttccaattatgagcttggagatttagac
ggcttcaaagaacaattaaggcttcaggaacaggtcatcaagaaactgcaagacaagctt
agcaatatggaaaacgagaaccgaaatcaaaacagcgagatcgacaatctgaaacgtaag
ttacaagggcaagacaatgcccaaagcgaaatcagcgatctgaaacgctcggtacaagac
ctgaataacaaaattaaatga

DBGET integrated database retrieval system