KEGG   Serratia plymuthica 4Rx13: SOD_c47290Help
Entry
SOD_c47290        CDS       T02710                                 

Gene name
phoU
Definition
(GenBank) phosphate transport system protein PhoU
  KO
K02039  phosphate transport system protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SOD_c47290 (phoU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoU CCDC154 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AGO57661
UniProt: S0ALI0
Position
5313891..5314625
Genome map
AA seq 244 aa AA seqDB search
MDNLNLNKHISGQFNAELEHIRTQVLTMGGLVEQQLTDAITAMHNQDGELAKRVIEGDAK
VNMMEVAIDEACVRIIAKRQPTASDLRLVMAIIKTISELERIGDVADKICRTALEKFSHQ
HQPLLVSLESLGRHTVQMLHDVLDAFARMDLDEAIRIYREDKKVDQEYEGIVRQLMTYMM
EDTRTIPSVLTALFCARSIERIGDRCQNICEFIFYFVKGQDFRHIGGDALEKLLSADGKV
EKKE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggacaacctgaatttaaataaacacatttccggccagttcaacgcagaacttgagcac
atccgtacccaggtgttgaccatgggcgggctggtggaacagcaactgaccgacgctatc
accgcgatgcataatcaggacggtgaactggccaaacgcgttatcgaaggtgacgccaag
gtcaatatgatggaagtggcgatcgacgaagcctgcgtgcgcatcattgccaagcgccag
ccgaccgccagcgatctgcgtctggtgatggcgatcatcaagaccatctccgagctggaa
cgtatcggcgacgtggcggataaaatttgtcgcaccgcgctcgagaaattctcgcaccag
catcagccgttgctggtcagcctggagtcgcttggccgccataccgtgcagatgctgcat
gacgtgctggacgcctttgcgcgtatggatctggatgaagctatccggatttaccgcgaa
gacaagaaggtcgatcaggagtatgagggcatcgtccgtcagttgatgacctatatgatg
gaagacacccgcactattccaagcgtgctgactgcgctgttctgcgcccgttcgatcgag
cgtatcggcgaccgttgccagaacatctgcgaatttattttctactttgtgaaaggtcag
gatttccgtcatattggcggcgatgcgctggaaaaactgctgtctgccgacggcaaagta
gaaaaaaaagagtaa

DBGET integrated database retrieval system