KEGG   Serratia plymuthica 4Rx13: SOD_c47300Help
Entry
SOD_c47300        CDS       T02710                                 

Gene name
glnH
Definition
(GenBank) ABC transporter glutamine-binding protein GlnH
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
srl  Serratia plymuthica 4Rx13
Module
srl_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:srl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srl02000]
    SOD_c47300 (glnH)
Transporters [BR:srl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    SOD_c47300 (glnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: AGO57662
UniProt: S0AMA7
Position
5314795..5315634
Genome map
AA seq 279 aa AA seqDB search
MKHRALALTLLASLTSLATGAAHADKLDDIKKAGVVRIAVFDSNPPFGYIDPQSKKLVGY
DVDVADAIGKALGVKVELRATNPANRIPLLVSKKVDLIAANFTITDERAKEVNFSVPYFA
TGQKFIARKGVLKTPEDIKKLRIGADKGTVQEITLREHYPTAKVISYDDTPLAFVALRNG
NVQAITQDDAKLVGLLGNLPAAQKADFEISPFSITKEYQGVGIPKGEDRLTASINDTLIK
LEKDGEAVKIYDRWFGPETKTAQPRGDFKIAPLDQQPKA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccgcgctttggccttaactctgttagccagcctgaccagcctcgccaccggc
gccgcacatgcggataaactcgacgacatcaagaaagccggcgtagtgcgtatcgcggtg
ttcgacagcaacccgccgttcggctatatcgatccgcaaagcaaaaagttggtcggttat
gacgttgacgtcgcagatgcgatcggcaaggcgctgggcgtaaaagttgagctgcgtgcc
accaacccggctaaccggattcccttgctggtatccaagaaggtcgatttgatcgccgcc
aacttcaccattaccgacgagcgcgccaaggaagtgaatttcagcgtgccgtatttcgct
accggccagaaatttatcgcccgtaaaggcgtgctgaaaaccccggaagacattaaaaag
ctgcgcatcggtgcagataaagggacagtgcaggaaatcaccctgcgtgaacattaccca
acggcaaaagtgatctcttacgacgataccccgttggcctttgtggcgctgcgtaacggc
aacgtacaggcgatcactcaggatgacgccaagctggttggcctgctcggcaacctgccg
gcggcgcagaaagccgattttgagatttcaccgttcagcatcaccaaagagtaccagggc
gtcggcattccaaaaggggaagatcgcctgaccgccagcattaacgacacgctgatcaag
ctggaaaaagacggcgaagcggttaagatctacgaccgctggttcggcccggaaaccaaa
accgcccaaccgcgcggcgatttcaagatcgcgcctttggatcaacagccaaaagcctga

DBGET integrated database retrieval system