KEGG   Serratia plymuthica 4Rx13: SOD_c47410Help
Entry
SOD_c47410        CDS       T02710                                 

Definition
(GenBank) putative membrane protein insertion efficiency factor
  KO
K08998  uncharacterized protein
Organism
srl  Serratia plymuthica 4Rx13
Brite
KEGG Orthology (KO) [BR:srl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SOD_c47410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Haemolytic
Motif
Other DBs
NCBI-ProteinID: AGO57673
UniProt: S0AKK9
Position
complement(5326690..5326947)
Genome map
AA seq 85 aa AA seqDB search
MASPLSPGSRILIGLVRAYQLVISPLLGPRCRFQPTCSHYAIEALSRFGMIKGSWLALKR
VLKCHPLNPGGDDPVPPKTDDNREH
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgccactgtcgccaggctcccgcatcctgatcgggctggtgcgggcttaccag
ctcgtcatcagtccgttgcttgggcctcgttgtcgcttccagccgacatgttctcattac
gcaattgaggcattaagcaggtttggcatgataaaaggcagttggttagcattgaaacgc
gtattaaaatgccaccccttgaacccaggtggcgatgatcccgtgccgccgaaaaccgac
gataacagagaacactaa

DBGET integrated database retrieval system