KEGG   Salinibacter ruber M8: SRM_01814Help
Entry
SRM_01814         CDS       T01209                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
srm  Salinibacter ruber M8
Pathway
srm00561  Glycerolipid metabolism
srm00640  Propanoate metabolism
srm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SRM_01814 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SRM_01814 (gldA)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SRM_01814 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase SpoVS LEA_5
Motif
Other DBs
NCBI-ProteinID: CBH24735
UniProt: D5H9N0
Position
2071464..2072558
Genome map
AA seq 364 aa AA seqDB search
MADVFQSPAAYVQGRGVVDAIGTHAASLGEQALLLADDTVLEIVEDRVRTSLAEAGLDAT
AAKFEGEASEAETERLTRIARTHDTDVVVGAGGGKALDTAKAVREGLDGGAMVSMPTVAS
TDAPTRALSVIYSDRGEFEEYWFYDAHPDLVLVDTEIIAAAPTRFFRSGIADGLATWFEA
DATFRSEGETIVGGTPTRAGHQLARLCYETLRDHGLSAIDAVERDAVTEAVEAVTEANTL
LSGLGFESGGLAAAHSIHNGLTQLDATHEATHGEKVNIGIITQLLLEGRESSVVEDYIAF
SRRLGLPVTLADIGIEDPTGRPLHTVAEAACDDSETIHNQPFRVTVPMVRDALKTVDGIA
DRVR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtttttcagtcccccgcagcatacgtgcaaggacggggcgttgtcgacgcg
atcgggacccacgcggcgtccctgggcgaacaggcactgcttctggccgacgataccgtt
ctcgaaatcgtcgaggatcgcgtgcggaccagtctggcggaggcaggactggacgcaacg
gccgctaaatttgaaggggaagcctccgaagcagagaccgagcgactgacgcgaatcgcc
cgtacccacgacaccgacgttgtcgtcggcgcggggggcggcaaggcgttggacacggcc
aaggccgttcgcgaaggcctggacggcggcgccatggtctcgatgcccaccgttgcctcg
acggatgccccgacgagggcgctgtcggtcatctactcggaccgcggcgagtttgaggaa
tactggttttacgacgcgcaccctgacctcgtgctggtcgataccgaaatcattgcggcc
gctccgacgcgcttcttccgatcggggattgccgacggcctcgcgacgtggttcgaggcc
gacgccaccttccgctcggagggagaaaccatcgtcgggggcacccccactcgggcgggc
catcaactcgcccggctctgttacgagacgctgcgggaccacgggctgtcggccatagac
gcggtagagcgcgatgccgttacggaagcggtggaggccgtcaccgaggccaacacgctc
ctcagcggcctcgggttcgagagcggagggctcgccgccgcacactccatccacaacggg
ctcactcagctcgacgccacgcacgaggccacgcacggagagaaggtcaacattgggatc
atcacccaactccttctggagggccgtgagagcagcgtcgtcgaggactatatcgcgttt
tcccggaggcttggcctgccggtcacgcttgccgacatcgggatcgaagatccaacgggc
cgtccccttcacaccgttgccgaagcagcctgcgacgattcagagacgatccacaaccag
ccgttccgggttaccgtccccatggtgcgggacgccctgaagacggtcgacgggattgcc
gatcgggtccggtag

DBGET integrated database retrieval system