KEGG   Salinibacter ruber M8: SRM_01860Help
Entry
SRM_01860         CDS       T01209                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
srm  Salinibacter ruber M8
Brite
KEGG Orthology (KO) [BR:srm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SRM_01860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CBH24781
UniProt: D5H9S6
Position
complement(2123411..2124256)
Genome map
AA seq 281 aa AA seqDB search
MTVGDPFLIGGVIIACFVAFNIGGATTGPAFGPAVGANVLSKTTAGALMAVAFFGGAYTI
GRRVVDTLGTELVHDPSVFTLEASIIVLFFIGGALLVGNLSGAPASTSMTAVGAIIGLGL
ASGELNFAVVGEILAWWILSPIIGFWLAVMVGRYGYEALDRRVAIEQSDGPLLAFERVEL
GRWPVVRLRESPVVRMERISPKLWPALGPNTSWREAVGTAVLVSIGFLMAFSSGTSNIAN
AIAPLVGSGALAMNPGILIGCGAVAVGGPHDCPPDHGDARQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgacggtgggcgatccgtttctcatcggtggcgtcatcattgcgtgcttcgtcgcgttc
aacatcggcggcgcgacgaccgggccggccttcgggccggcggtgggggcgaacgtccta
tcgaagaccaccgcgggggcgctcatggcggtggccttcttcggcggggcctacacgatt
gggcgtcgcgtcgtggacacgctgggcacggagctggtccacgacccgtccgtcttcacg
ctcgaagccagcatcatcgtgctgttcttcattggcggggcgctgctcgtgggcaacctt
tcgggggccccggcatccacgtcgatgacggcggtgggggccatcattggcctcggcctt
gcgagcggggagctcaactttgccgtcgtgggagaaattctcgcctggtggatcctgtcc
cccatcattggcttttggctcgccgtcatggtggggcgctacgggtacgaggcgctcgac
cggcgcgtcgccatcgagcagagtgacggcccgctgctggcgttcgagcgtgtagagctg
gggaggtggcctgtggtccgtctccgcgagtcccccgtcgtgcggatggagcgcatcagc
ccgaagctgtggccggcccttgggcccaacacgtcgtggcgcgaggcggtgggcacggcc
gtgctggtgagcatcgggtttttgatggcgtttagctcgggcaccagcaacattgccaac
gccatcgcgccgctggtgggaagcggcgccctggccatgaaccccggcatcctcatcggg
tgtggggccgtggcggtggggggccctcacgattgcccgccggaccatggagacgctcgg
caatga

DBGET integrated database retrieval system