KEGG   Salinibacter ruber M8: SRM_01888Help
Entry
SRM_01888         CDS       T01209                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
srm00010  Glycolysis / Gluconeogenesis
srm00620  Pyruvate metabolism
srm00640  Propanoate metabolism
srm00680  Methane metabolism
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_01888 (acs)
   00620 Pyruvate metabolism
    SRM_01888 (acs)
   00640 Propanoate metabolism
    SRM_01888 (acs)
  Energy metabolism
   00680 Methane metabolism
    SRM_01888 (acs)
Enzymes [BR:srm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SRM_01888 (acs)
Lipid biosynthesis proteins [BR:srm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SRM_01888 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBH24809
UniProt: D5H9V4
Position
complement(2153770..2155761)
Genome map
AA seq 663 aa AA seqDB search
MADADAALEARLSDQEYLRPPSAFVGQANVSDPAIYDRFDDFPEGFEEYADLLDWDTRWD
EVFDGSDPPFFEWFTGGELNACYNCVDRHLHERPNQAAFIWEGEDGTRRTLTYRDLYREV
NKMAASLRDVGVQEDDVVTLHLPMVPALPITMLACARIGAPHSVVFGGFSASALAQRATD
ADSDVIVTIDGYYRRGEFLHHKEKADTAVEEADTDIDTVLVWERHEGTLHPEADLEEGRD
ILVSELLANNERARVEPVSRDAEDTLFLMYTSGTTGKPKGAQHRTGGYLSYVAGTSKYVL
DIKPNDTYWCAADIGWITGHSYIVYGPLALGTTSVMREGAPDHPHKGVTWEIAERHDVDI
FHTSPTAVRMYMKWGKEHPASYDFNFRHMTTVGEPIQPEAWLWYYTHIGNEDAVIVDTWW
QTETGGHLITNLPALQDMKPGSAGRPCPGIQPAIYDNNGTPVEAASGQAGNLVIERPWPG
MLQTVYGDDQRFINEYWRRFSDVDSDDWRDWVYEAGDGAVHAQDGYFRVLGRLDDVMNVA
GHRLGTMELESAVAQVSEVAEAAVAARQDDQKGNVPDVYVTPRDGVAASDELRQDIVAAV
EKEIGAFARPGNVIFVGDLPKTRSGKIMRRLLENISNGKDLGDTTTLRDPSVPEEIRRQV
QEA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgccgacgctgccctcgaagcccgactgtccgaccaggagtatctccgccct
ccctccgcattcgtggggcaggccaacgtgtcggacccggcgatctacgatcggttcgac
gactttccggaaggatttgaggagtacgccgaccttctagactgggacacccgctgggac
gaggtcttcgacgggtccgacccgcccttctttgagtggtttacgggcggggagctcaac
gcctgctacaactgcgtggaccgtcacctccacgagcggcccaaccaggcggccttcatc
tgggaaggcgaggacggcacccggcgcacgctgacgtaccgggatctctaccgggaagtc
aacaagatggcggcctcgctccgcgatgtgggcgtccaggaggatgacgtggttacgctc
caccttccgatggtgcccgcgctgcccatcaccatgctcgcctgtgcccgcatcggcgcg
ccgcactcggtcgtatttggcggcttctcggccagcgccctcgcccaacgcgccaccgat
gccgactccgacgtcatcgtcacgatcgacggctactaccggcggggcgagttcttgcac
cacaaggagaaggccgacaccgccgtggaggaggcggacaccgacatcgacacggtgcta
gtgtgggagcgccacgagggaacccttcaccccgaggccgacctggaggagggacgcgac
atcctcgtgtccgagctcctcgccaacaacgaacgggcgcgagtcgagccggtgtcgcgc
gacgccgaagacactctcttcctgatgtacacgtccggcaccaccggcaagccgaagggg
gcccagcaccgcaccggcggctacctcagctacgtggcgggcacgtcgaagtacgtcctc
gacatcaagcccaatgacacctactggtgtgccgccgacatcggatggattaccggccac
tcctacatcgtctacggcccgctcgccctgggcacgacgagcgtgatgcgggagggcgcg
cccgaccatccgcacaagggcgtcacctgggaaattgccgagcggcacgacgtcgacatc
ttccacacctcgcccacggcggtgcggatgtacatgaagtgggggaaggagcacccggcg
tcgtacgacttcaacttccgccacatgacgacggtcggggagcccattcagccggaggcg
tggctctggtactacacgcacatcggaaacgaggacgccgtcatcgtcgacacctggtgg
cagacggagacggggggccacctcatcaccaacctgccggccctacaggacatgaagccc
ggctcggccgggcgtccgtgccccggcatccagccggccatctacgacaacaacggcacg
cccgtggaggccgcgagcgggcaggccggcaacttggtgatcgagcgcccctggccgggc
atgctgcagaccgtgtacggcgacgaccagcgcttcatcaacgagtactggcgccgattc
tcggacgtcgactccgacgactggcgcgactgggtctacgaggccggggacggggccgtg
cacgcccaggacggctacttccgcgtcctggggcgcctcgacgacgtgatgaacgtggcc
gggcaccggctcggcaccatggagctggagtcggccgtggcccaggtgtccgaggtggcc
gaggccgcagtggccgcgcggcaggacgaccagaagggaaacgtgcccgacgtgtacgtc
acgccccgcgacggggtggcggcgtccgacgagctccggcaggacatcgtcgccgccgtt
gagaaagagatcggggcctttgcccgcccgggaaacgtcatcttcgtcggggatctcccc
aagacgcgctccggcaagattatgcgtcgcctcctcgaaaacatctccaacgggaaggac
ctcggcgacaccaccaccctccgcgacccgagcgtccccgaagaaatacggcggcaggtt
caggaggcgtag

DBGET integrated database retrieval system