KEGG   Salinibacter ruber M8: SRM_02116Help
Entry
SRM_02116         CDS       T01209                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
srm00010  Glycolysis / Gluconeogenesis
srm00051  Fructose and mannose metabolism
srm00562  Inositol phosphate metabolism
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01200  Carbon metabolism
srm01230  Biosynthesis of amino acids
Module
srm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
srm_M00002  Glycolysis, core module involving three-carbon compounds
srm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_02116 (tpiA)
   00051 Fructose and mannose metabolism
    SRM_02116 (tpiA)
   00562 Inositol phosphate metabolism
    SRM_02116 (tpiA)
Enzymes [BR:srm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SRM_02116 (tpiA)
Exosome [BR:srm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SRM_02116 (tpiA)
  Exosomal proteins of bladder cancer cells
   SRM_02116 (tpiA)
  Exosomal proteins of melanoma cells
   SRM_02116 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBH25037
UniProt: D5HAI2
Position
2428410..2429192
Genome map
AA seq 260 aa AA seqDB search
MLVAGNWKMNTDVPEGRALADAIAEGLSSTAADRGDVDFLVCPPYVHLPAVREALADVPV
AVGAQDMHAQDEGAYTGDVSAPMLSSIGCDAVILGHSERRTYYDETDAEVNAKAQQARAH
DLVPIVCVGETLEQRKAGEADTVVRSQVDGALSDVSIDGADELIVAYEPIWAIGTGESAA
AEQAQAMHAVIRDDLRERYGGDVADEVPLLYGGSMKPHNAYGLLSQPDIDGGLIGSASLE
AESFLGIAEKAAEVLETSGH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcgctggcaactggaaaatgaacactgacgtcccggaaggccgggcgctcgcc
gacgccatcgcggagggcctgtcgtccacggccgccgaccggggcgacgtcgacttcctc
gtctgccccccgtacgtccacctgccggccgtccgcgaggcgctggcggacgtccccgtc
gcggtgggggcccaggacatgcacgcacaggacgaaggggcctacacgggcgacgtgtcc
gcccccatgctgtcctccatcgggtgcgacgccgttattctcggccactccgagcggcgc
acgtactacgacgagaccgacgccgaggtcaacgcaaaggcccagcaggcccgtgcccac
gaccttgtgcccatcgtgtgcgtcggcgagaccctcgagcagcggaaggcgggggaggcc
gacacggtcgtccggagccaggtggacggggcgctgtcggatgtctcgatcgatggcgcg
gacgagctgatcgtggcctacgagccgatctgggccatcggcacgggggaatccgccgcc
gccgagcaggcgcaggcgatgcacgcggtgatccgggacgacctgagggagcgctacggg
ggcgacgtggcggacgaggtgccgctcctctacggcggcagcatgaagccgcacaacgcc
tacggccttctctcccagccggacatcgacgggggcctcatcggcagcgcgagcctcgag
gcggagagcttcctcggtatcgccgagaaggcggcagaggtgctcgagacgtccgggcac
tga

DBGET integrated database retrieval system