KEGG   Salinibacter ruber M8: SRM_02162Help
Entry
SRM_02162         CDS       T01209                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
srm  Salinibacter ruber M8
Pathway
srm00790  Folate biosynthesis
srm01100  Metabolic pathways
Module
srm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRM_02162 (folP)
Enzymes [BR:srm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SRM_02162 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase AP_endonuc_2 AAA_25
Motif
Other DBs
NCBI-ProteinID: CBH25083
UniProt: D5HAM8
Position
complement(2488704..2489723)
Genome map
AA seq 339 aa AA seqDB search
MDLVPTALCVYLAPTSVRGSPLLETRPPAPPMPRMSRSTPSLNPDDFPTDRFVLGGDDYT
LDCRPGSPEAAGAHVMGVLNVTPDSFSDGGQYVTVEKALSRAAEMLSEGASIIDVGGEST
RPGADPVSKEDERDRVVPVIDALTDRFPEAVVSVDTYKPDVARASLAAGADIVNDVTGLR
HDPEMAAAAADWKAPLMVMHSMGEPGDLTRPREYDDVTAQVRDALARTVETAEQAGVEQV
IIDPGFGFGKSDAENFRLLNEIDELLTLNCPVLVGVSRKSTIGATLGTPDDPAPVDERLF
GSLGATAAAVARGATIVRTHDIAPTVEMLKVLGVTLRQR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgttccgacagcgctctgtgtataccttgccccaacaagtgttcgtggctct
ccgcttcttgaaacgcgtccccctgctcctccgatgccccgcatgtcgcgctcaaccccg
tcgctgaatcctgacgattttcccaccgatcggttcgtgctcggtggggacgactacacg
ctcgactgccggcccgggagcccggaggctgcgggggctcacgtgatgggagtcctgaac
gtgacccccgactccttttccgacggcggtcagtacgtgaccgtcgagaaggcactgtcg
cgggccgccgagatgttgagtgagggggcctccatcatcgacgtcgggggcgagtcgacc
cggcccggggcggatcccgtctcgaaagaagacgagcgcgaccgggtggtgcccgtcatc
gacgccctcacggatcggttccccgaagcggtggtgtcggtcgacacctacaagcccgac
gtggcccgggcgtccctcgccgcgggggcggacatcgtgaacgacgtcaccggcctgcgg
cacgatcccgagatggccgcggccgcggccgactggaaggcgcccctcatggtcatgcac
tcgatgggcgagcccggcgacctcacgcggccccgcgagtacgacgacgtgacggcccag
gtgcgcgacgcactggcccggacggtggagaccgccgagcaggccggtgtggagcaggtg
atcatcgatccgggcttcggcttcgggaagtccgacgccgaaaacttccgcctgctcaac
gagatcgacgagcttctcaccctcaactgccccgtgctcgtgggcgtctcccgcaagagc
acgatcggggccacgctgggcacgcccgacgaccccgcgcccgtggacgagcggctcttc
gggtcgctcggggcgacggcggcggccgtggcgcggggggccaccatcgtgcgcacccac
gacatcgcccccaccgtcgagatgctcaaggtgctcggggtcaccctccgccaacggtag

DBGET integrated database retrieval system