KEGG   Salinibacter ruber M8: SRM_02533Help
Entry
SRM_02533         CDS       T01209                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
srm  Salinibacter ruber M8
Pathway
srm00010  Glycolysis / Gluconeogenesis
srm00071  Fatty acid degradation
srm00350  Tyrosine metabolism
srm00625  Chloroalkane and chloroalkene degradation
srm00626  Naphthalene degradation
srm01100  Metabolic pathways
srm01110  Biosynthesis of secondary metabolites
srm01120  Microbial metabolism in diverse environments
srm01130  Biosynthesis of antibiotics
srm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:srm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRM_02533 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SRM_02533 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SRM_02533 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SRM_02533 (adh)
   00626 Naphthalene degradation
    SRM_02533 (adh)
Enzymes [BR:srm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SRM_02533 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBH25454
UniProt: D5HBP9
Position
2948524..2949762
Genome map
AA seq 412 aa AA seqDB search
MNELSFLYVPFFPDVTAPQSPLSIRGGSSPWIPCLETRPESIGTGLRTFRVPSRTTPPEG
AVRFACTTAPSALMSTMQAARIPSAGADFEIVDLPVPDPDAHEVRVRVEACGICHSDAFV
KEGTFPGLEYPRVPGHEVAGVVDAVGTDVTQWSEGDRVGVGWHGGHCFTCDACRTGDFVN
CENGLVTGIHYDGGYAEYMTAPAEAVAKMPEALAAEDAAPLLCAGITTFNALRNQDLQPG
DLVAVQGIGGLGHLGVQYAAAMGLEVVALSTSADKEELAHDLGASHFVDVSSTDPAEALQ
HQGGADLILATAPNADAITSVVGGLGRDGDLVIVAATGEAVEVPPMALIQGRKSVSGWPS
GDAKDSEDTLAFSAQAEALPEIETFSLEEAGAAYDRMINNEARFRAVLTMDH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagctctcatttctctacgtgcctttcttcccagacgttacagcaccgcagtcc
cctttgtcaatccggggtgggtcctcgccgtggattccctgcctggaaacgcggccggag
tcgatcggtaccggtctacggacttttcgggttccttccagaacgactcctccggaggga
gccgttcgattcgcctgcacaacagccccttctgccctcatgtccaccatgcaagccgcc
cgcattcccagtgccggggccgactttgaaatcgttgaccttcctgtgcccgaccccgac
gcccacgaggtgcgcgttcgcgtcgaggcgtgtggcatctgtcacagcgacgccttcgtg
aaggagggcacgttccccggcctcgaataccctcgcgtgccggggcacgaggtcgccggg
gtggtcgacgccgtgggaacggatgtcacccagtggtcggagggcgaccgcgtgggggtc
ggctggcacggcggccactgcttcacctgcgacgcctgtcgcacgggcgactttgtgaac
tgcgagaacggcctcgtgaccggcatccactacgacggcggctacgccgagtacatgacc
gcccccgccgaggccgtggcgaagatgccggaggccctggccgccgaagacgccgcgccc
ctgctctgcgccggcatcaccacgttcaacgcgcttcgcaatcaggacctgcagcccggc
gacctcgtcgcggtgcagggcatcggcggactgggccacctgggcgtgcagtacgccgcg
gcgatgggcctggaggtggtggcgctctccacgagtgccgacaaggaagaactggcccac
gacctcggggcctcccacttcgttgacgtctcgagcaccgacccggccgaggcgctccag
caccagggcggggccgacctcatcctggccaccgccccaaacgccgacgccatcacgtcg
gtcgtcggcgggctgggccgcgacggggacctcgtgatcgtcgccgcgacgggagaggcg
gtcgaggtcccgccgatggcgctcattcagggccgcaagtcggtctccggctggcccagc
ggcgacgcgaaggactcggaggacacgctcgcgttcagcgcgcaggccgaggcgctgccc
gagattgagaccttctctctagaggaggccggggccgcctacgaccgcatgatcaacaat
gaggcccgcttccgcgcggtcctcacgatggaccattag

DBGET integrated database retrieval system