KEGG   Streptomyces rubrolavendulae: A4G23_00950Help
Entry
A4G23_00950       CDS       T04616                                 

Definition
(GenBank) Putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00010  Glycolysis / Gluconeogenesis
srn00053  Ascorbate and aldarate metabolism
srn00071  Fatty acid degradation
srn00280  Valine, leucine and isoleucine degradation
srn00310  Lysine degradation
srn00330  Arginine and proline metabolism
srn00340  Histidine metabolism
srn00380  Tryptophan metabolism
srn00410  beta-Alanine metabolism
srn00561  Glycerolipid metabolism
srn00620  Pyruvate metabolism
srn00625  Chloroalkane and chloroalkene degradation
srn00903  Limonene and pinene degradation
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
srn01120  Microbial metabolism in diverse environments
srn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4G23_00950
   00053 Ascorbate and aldarate metabolism
    A4G23_00950
   00620 Pyruvate metabolism
    A4G23_00950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4G23_00950
   00561 Glycerolipid metabolism
    A4G23_00950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4G23_00950
   00310 Lysine degradation
    A4G23_00950
   00330 Arginine and proline metabolism
    A4G23_00950
   00340 Histidine metabolism
    A4G23_00950
   00380 Tryptophan metabolism
    A4G23_00950
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4G23_00950
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A4G23_00950
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A4G23_00950
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A4G23_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOT58146
UniProt: A0A1D8FYA2
Position
complement(1113456..1114847)
Genome map
AA seq 463 aa AA seqDB search
MKVHDGMYIGGAWRPADGTGTITVVNPATEEPFATVPAGEAADVDAAVRAARTAFPGWAA
TPPAERAARLAALRDALAARQDEIAATVTAELGAPPKLAHAVHAGLPVTVAGSYAELLRT
YAFEERIGNSTVLLEPVGVVGAITPWNYPLHQIVAKVAPALAAGCTVVVKPAEETPLTAR
LFAECAHAAGFPAGVVNVVTGLGHVAGQALVDHDGVDMVSFTGSTAVGRRIGAAAGGSVK
RVALELGGKSASVILPGADLPRAVAGSVASVMSNSGQRCNALTRVLVRADRYEEAVALAA
EAAAKHPAGDRIGPLVSAAQRDRVVAYIEKGVAEGARIVAGGPRPPLERGFYVAPTVFAD
VTPDMTIAQEEIFGPVVAFLRYEDEEDALRIANGTVYGLAGAVWGEPEAAAAFARRMDAG
QVDVNGGRFNPLAPFGGYKQSGVGRELGAHGLAEYLHTKSLQF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccacgacgggatgtacatcggcggtgcgtggcggcccgccgacggcaccggc
accatcaccgtggtgaacccggcgaccgaggagcccttcgccaccgtcccggccggtgag
gcggccgacgtcgacgccgccgtgcgggccgcgcggaccgccttccccggctgggccgcc
accccgcccgcggagcgcgccgcccggctggccgccctccgcgacgcgctcgccgcccgc
caggacgagatcgccgcgaccgtcaccgccgagctgggcgccccgccgaagctcgcccac
gccgtgcacgccggactgccggtcacggtggccggctcgtacgccgaactcctccgcacg
tacgcgttcgaggagcggatcggcaattccacggtgctgctggagccggtcggcgtcgtc
ggcgcgatcacgccgtggaactacccgctgcaccagatcgtcgccaaggtcgccccggcc
ctcgcggcgggctgcaccgtcgtcgtcaagccggccgaggagaccccgctgacggcgcgc
ctgttcgccgagtgcgcgcacgccgccgggttcccggcgggcgtcgtcaacgtcgtcacc
ggcctcgggcacgtcgccgggcaggcgctcgtcgaccacgacggcgtcgacatggtctcc
ttcaccggctccaccgccgtcggcaggcggatcggcgccgccgcgggcggctcggtcaag
cgggtcgccctggagctgggcggcaagtccgcgagcgtgatcctgcccggcgccgacctg
ccgagggcggtcgccgggagcgtcgccagcgtcatgtccaactccggccagcgctgcaac
gccctcacccgcgtcctcgtgcgggcggaccggtacgaggaggccgtcgccctcgccgcc
gaggccgccgcgaagcacccggcgggcgaccggatcggcccgctggtcagcgccgcccag
cgggaccgcgtcgtcgcgtacatcgagaagggcgtcgccgagggcgcccggatcgtcgcg
ggcggcccccggccgccgctggagcgcggcttctacgtcgcgccgaccgtcttcgccgac
gtgacccccgacatgacgatcgcccaggaggagatcttcggcccggtggtggcgttcctg
cggtacgaggacgaggaggacgccctgcgcatcgccaacggcacggtctacggcctggcc
ggggccgtgtggggcgagccggaggccgccgccgccttcgcccgccgcatggacgccggg
caggtggacgtcaacggcggccggttcaacccgctcgccccgttcggcgggtacaagcag
tccggcgtcggccgcgagctgggcgcccacggcctcgccgagtacctccacaccaagtcc
ctccagttctga

DBGET integrated database retrieval system