KEGG   Streptomyces rubrolavendulae: A4G23_02448Help
Entry
A4G23_02448       CDS       T04616                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00520  Amino sugar and nucleotide sugar metabolism
srn01100  Metabolic pathways
srn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A4G23_02448 (nagA)
Enzymes [BR:srn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     A4G23_02448 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AOT59606
UniProt: A0A1D8G2E7
Position
2889204..2890364
Genome map
AA seq 386 aa AA seqDB search
MAVHADRKVLAGARVVLPTGVAEGGRVAVEGARIADAAALPADAPALDLTGHWLVPGFVD
LHNHGGGGASFTSGTVEEVLRGIRTHREHGTTTLVASTVTGDMDFLAHRAGELSELAEQG
DIAGIHFEGPFISPCRKGAHSEALLRDPDPAEVRKLIDAARGQARMVTLATELPGGVDSV
HLLAEHGVIAAIGHTDATYEQTVEAIEAGATVATHLFNAMPALGHRAPGPIAALLEDERV
TVELINDGTHLHPAALELAFRHAGAGRVAFITDAMDAAGFGDGVYHLGPLEVEVREGVAR
LVEGGSIAGSTLTLDTAFRRAATVDGLPVESIVQAVSANPAKLLGLYDRIGSIEPGKDAD
LVVLDEEFTLKGVMRRGEWVIEPQVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggccgttcacgccgaccgcaaggtcctcgccggggcccgtgtggtgctgccgaccggc
gtcgccgagggcgggcgggtcgccgtcgagggcgcccgcatcgccgacgcggccgcactc
cccgccgacgcgcccgcgctggacctcacgggccactggctggtgcccggcttcgtcgac
ctccacaaccacggcggcggcggcgcctccttcacctccggcaccgtggaggaggtcctg
cggggcatccgcacccaccgcgagcacggcacgacgaccctcgtcgcgtcgaccgtcacc
ggcgacatggacttcctcgcccaccgcgcgggcgagctgtccgagctggccgagcagggc
gacatcgcgggcatccacttcgagggcccgttcatctccccctgccgcaagggcgcccac
agcgaggccctgctgcgcgaccccgacccggccgaggtccgcaagctgatcgacgcggcg
cgcggccaggcccgcatggtgaccctcgcgaccgagctgcccggcggcgtcgactccgtg
cacctcctcgcggagcacggcgtcatcgccgccatcggccacaccgacgccacgtacgag
cagaccgtggaggccatcgaggcgggcgcgaccgtcgcgacgcacctgttcaacgcgatg
cccgcgctcgggcaccgcgcccccggcccgatcgccgccctcctggaggacgagcgggtc
accgtcgagctgatcaacgacggcacgcacctgcacccggccgccctggagctggcgttc
cgccacgccggggccgggcgggtcgcgttcatcacggacgccatggacgcggccgggttc
ggggacggggtctaccacctcggcccgctggaggtcgaggtcagggagggggtggcccgg
ctggtcgagggcggctccatcgccgggtccaccctcaccctcgacaccgccttccggcgc
gccgccaccgtcgacgggctgcccgtcgagtcgatcgtccaggccgtctccgccaacccg
gcgaagctgctcggcctgtacgaccggatcggctccatcgagccgggcaaggacgccgat
ctggtcgtcctggacgaggagttcacgctcaagggcgtcatgcgccggggcgaatgggtg
atcgagccacaagtgggttga

DBGET integrated database retrieval system