KEGG   Streptomyces rubrolavendulae: A4G23_02592Help
Entry
A4G23_02592       CDS       T04616                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00310  Lysine degradation
srn01100  Metabolic pathways
srn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    A4G23_02592 (lhgO)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     A4G23_02592 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Amino_oxidase NAD_binding_8 Pyr_redox_2 Thi4 FAD_binding_3 Lycopene_cycl Pyr_redox FAD_binding_2 Mqo GMC_oxred_N Trp_halogenase HI0933_like FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AOT59746
UniProt: A0A1D8G2T7
Position
3049041..3050252
Genome map
AA seq 403 aa AA seqDB search
MSGFGGGMFDCDVLVVGGGIIGLSTAYALSRAAPGTRVVVLEKEGGPARHQTGRNSGVIH
SGIYYRPGSLKARFAVRGAAEMVKFCAEYGLPHRVTGKLIVATDRAELPRLHALVQRGRE
NGIPVRELGPAQISAYEPEVRGIAAIHVGTTGICDYGAVAERLADASGAEVRYGARVTAV
DRRPWGVAARTADGRVVRARALVNCAGLHCDEVARLAGDDPGMRIVPFRGEYYELGRPEL
VRGLVYPVPDPAFPFLGVHLTRGVDGGVHVGPNAVPALAREGYGRLDVRPRELAGTLAWP
GTWAIARRHWRYGAGELHRSLSKPAFTQAVRRLLPQVAAEDLRPAPAGVRAQAVLRDGTL
VDDFLIREAPRTVHVLNAPSPAATASLPIGREVARRVLARLAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgggttcggcggcggcatgttcgactgcgacgtcctggtggtgggcggcgggatc
atcgggctgtcgacggcgtacgcgctgtcgcgggccgcgcccggcacgcgcgtggtggtc
ctggagaaggagggcggccccgcccgccaccagacggggcgcaacagcggcgtcatccac
agcggcatctactaccgccccggctcgctcaaggcgcggttcgcggtgcggggcgccgcc
gagatggtgaagttctgcgccgagtacgggctgccgcaccgcgtcaccggcaagctgatc
gtcgccaccgaccgcgccgagctgccccggctgcacgccctggtgcagcgcggccgggag
aacggcatcccggtccgggagctgggcccggcgcagatcagcgcgtacgagccggaggtg
cggggcatcgcggcgatccacgtcggcaccaccgggatctgcgactacggcgcggtggcg
gagcgcctcgccgacgcctccggcgccgaggtgcggtacggggcgcgggtcaccgccgtc
gaccggcgcccctggggcgtggcggcccgcacggcggacggccgggtcgtccgcgcgcgg
gcgctggtgaactgcgccggactgcactgcgacgaagtggcgcggctcgcgggggacgac
ccgggcatgcggatcgtcccgttccggggcgagtactacgagctgggcaggcctgagctg
gtgcggggcctggtgtatccggtaccggacccggcgttcccgttcctgggggtgcacctg
acgcggggggtcgacggcggcgtccacgtcgggccgaacgcggtgcccgccctggcccgc
gaggggtacgggcgtctggacgtgcgcccccgcgagctggccgggacgctggcctggccg
ggtacgtgggcgatagcgcggcggcactggcggtacggggcgggcgagctgcaccggtcg
ctgtcgaagccggcgttcacgcaggccgtgcggcgcctgctgccgcaggtcgcggccgag
gacctgcggcccgccccggccggggtgcgggcccaggcggtgctgcgggacggcacgctg
gtggacgacttcctgatcagggaggcaccgcgcacggtccatgtgctgaacgccccctcc
cccgccgcgacggcgtccctgcccatcgggcgggaggtggcgcggcgggtcctggcgcgt
ctggccgcttag

DBGET integrated database retrieval system