KEGG   Streptomyces rubrolavendulae: A4G23_02737Help
Entry
A4G23_02737       CDS       T04616                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00030  Pentose phosphate pathway
srn00480  Glutathione metabolism
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
srn01120  Microbial metabolism in diverse environments
srn01130  Biosynthesis of antibiotics
srn01200  Carbon metabolism
Module
srn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
srn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A4G23_02737 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A4G23_02737 (gnd)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     A4G23_02737 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     A4G23_02737 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD 2-Hacid_dh_C F420_oxidored PAD_porph 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOT59879
UniProt: A0A1D8G351
Position
complement(3212414..3213289)
Genome map
AA seq 291 aa AA seqDB search
MELGLIGLGKMGGNMRERIRRAGHTVVGYDRNPDLADVHSLEELVGALKGPRVVWVMVPA
GEATQTTIDQLAELLSPGDVVVDGGNSRWTDDEKHAEELAAKGIGFVDCGVSGGVWGLEN
GYALMYGGDAEDVAKVQPVFDALKPEGEFGAVHAGKVGAGHFAKMVHNGIEYAMMQAFAE
GWELLEAVDSVTDVREVFRSWQEGTVIRSWLLDLAVRALDDDEHLEKLRGYAADSGEGRW
TVEAAIDNAVPLPAITASLFARFASRQDDSPQMKMIAALRNQFGGHAVENK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggagctcggtctcatcggcctcggcaagatgggcggcaacatgcgcgagcgcatccgc
cgcgcgggccacaccgtcgtcgggtacgaccgcaatcccgacctcgccgatgtccacagc
ctcgaggagctggtgggcgcgctgaagggcccgcgcgtcgtgtgggtgatggtcccggcc
ggcgaggccacccagaccaccatcgaccagctcgcggagctgctctcccccggcgacgtc
gtcgtggacggcggcaactcccgctggacggacgacgagaagcacgccgaggagctggcc
gccaagggcatcggcttcgtcgactgcggcgtctccggcggcgtctggggcctggagaac
ggctacgccctcatgtacggcggcgacgccgaggacgtcgccaaggtgcagccggtcttc
gacgcgctgaagccggagggtgagttcggagccgtccacgcgggcaaggtcggcgccggc
cacttcgcgaagatggtgcacaacggcatcgagtacgcgatgatgcaggccttcgccgag
ggctgggagctgctggaggccgtggactccgtcacggacgtccgcgaggtcttccgctcc
tggcaggaggggacggtcatccgctcctggctgctcgacctggcggtccgggcgctcgac
gacgacgagcacctggagaagctgcgcggctacgccgcggactccggcgagggccgctgg
acggtcgaggccgccatcgacaacgccgtgccgctgcccgcgatcaccgcgtcgctgttc
gcgcggttcgcgtcccgccaggacgactcgccgcagatgaagatgatcgccgcgctgcgc
aaccagttcggcggccacgcggtggagaacaagtaa

DBGET integrated database retrieval system