KEGG   Streptomyces rubrolavendulae: A4G23_03090Help
Entry
A4G23_03090       CDS       T04616                                 

Gene name
yfmT
Definition
(GenBank) Putative aldehyde dehydrogenase YfmT
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00010  Glycolysis / Gluconeogenesis
srn00053  Ascorbate and aldarate metabolism
srn00071  Fatty acid degradation
srn00280  Valine, leucine and isoleucine degradation
srn00310  Lysine degradation
srn00330  Arginine and proline metabolism
srn00340  Histidine metabolism
srn00380  Tryptophan metabolism
srn00410  beta-Alanine metabolism
srn00561  Glycerolipid metabolism
srn00620  Pyruvate metabolism
srn00625  Chloroalkane and chloroalkene degradation
srn00903  Limonene and pinene degradation
srn01100  Metabolic pathways
srn01110  Biosynthesis of secondary metabolites
srn01120  Microbial metabolism in diverse environments
srn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A4G23_03090 (yfmT)
   00053 Ascorbate and aldarate metabolism
    A4G23_03090 (yfmT)
   00620 Pyruvate metabolism
    A4G23_03090 (yfmT)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4G23_03090 (yfmT)
   00561 Glycerolipid metabolism
    A4G23_03090 (yfmT)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4G23_03090 (yfmT)
   00310 Lysine degradation
    A4G23_03090 (yfmT)
   00330 Arginine and proline metabolism
    A4G23_03090 (yfmT)
   00340 Histidine metabolism
    A4G23_03090 (yfmT)
   00380 Tryptophan metabolism
    A4G23_03090 (yfmT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4G23_03090 (yfmT)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A4G23_03090 (yfmT)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A4G23_03090 (yfmT)
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A4G23_03090 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AOT60223
UniProt: A0A1D8G477
Position
3590705..3592162
Genome map
AA seq 485 aa AA seqDB search
MSYFRDLALQYIDGEWRAGGGSWDIIDFNPFNEEKLASITVATVDEVDQAYRAAERAQAG
WAATNPYARRGVFERALRIIEDREPELIEAIVAELGGTRGKAAFELHLAREFMREAIHLS
LRPEGRILPSPIDGKENRLYRLPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPHQ
NTPILGGTMVAKVFEDAGLPPGVLNVVVTDIAEIGDALLEHPVPRVISFTGSDRVGRHVA
TVCAKHFKRAVLECGGNSALVVLDDADLDYAVDAAVFSRFIHQGQACMAANRVLVDRSVM
EEFTEKFVAKVRTLKTGDPAEDGTHIGPLINSSQVESVMAAVQQAVAAGARVLTGGTSEG
NVVVPTVLADIPAGAPVLSQEIFGPVAMLIPFDGEDEAVRIANDSPYGLSGGVHTRDVER
GVRFAQRVHTGMIHINDGIIHDEPIVPFGGEKHSGVGRLNGDATVEAFTTHKWISVQHGR
STFPI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacttcagagatctggccctgcagtacatcgacggtgaatggcgggccggcggc
ggctcgtgggacatcatcgacttcaacccgttcaacgaggagaagctcgcctccatcacc
gtcgccaccgtcgacgaggtggaccaggcgtaccgcgccgccgaacgggcgcaggccggg
tgggccgcgaccaacccgtacgcgcggcgcggcgtcttcgagcgggcgctgcggatcatc
gaggaccgcgagcccgagctgatcgaggcgatcgtcgcggagctcggcggcacgcgcggc
aaggccgccttcgagctgcacctcgcgcgcgagttcatgcgcgaggcgatccacctgtcg
ctgcggcccgagggccggatcctcccgtcgcccatcgacggcaaggagaaccggctctac
cggctgcccgtcggcgtcgtcggcgtgatcagcccgttcaacttccccttcctgctctcg
ctgaagtcggtggccccggcgctcgcgctcggcaacgcggtggtgctcaagccgcaccag
aacaccccgatcctcggcggcaccatggtggccaaggtcttcgaggacgccggcctgccg
ccgggcgtgctcaacgtcgtggtcaccgacatcgccgagatcggcgacgcgctgctggag
caccccgtcccgcgggtcatctccttcaccggctccgaccgggtcggccgccacgtggcc
accgtgtgcgccaagcacttcaagcgggccgtcctggaatgcggcggcaacagcgcgctc
gtcgtcctggacgacgcggacctcgactacgcggtggacgccgccgtgttcagccgcttc
atccaccagggccaggcgtgcatggccgccaaccgcgtcctggtcgaccgctccgtcatg
gaggagttcaccgagaagttcgtcgccaaggtccgcaccctgaagacgggcgacccggcc
gaggacggcacccacatcgggcccctgatcaactcctcgcaggtcgagtcggtcatggcc
gcggtgcagcaggccgtcgcggccggggcgcgggtcctgaccggcggcacgtccgagggg
aacgtcgtcgtgccgaccgtcctcgcggacatcccggccggcgccccggtcctgagccag
gagatcttcgggccggtcgcgatgctcatcccgttcgacggcgaggacgaggcggtgcgc
atcgccaacgacagcccgtacgggctcagcggcggcgtccacacgcgcgacgtcgagcgc
ggcgtgcggttcgcccagcgcgtccacacgggcatgatccacatcaacgacggcatcatc
cacgacgagccgatcgtccccttcggcggcgagaagcactccggggtgggccggctgaac
ggcgacgcgaccgtggaggcgttcaccacccacaagtggatctccgtccagcacgggcgg
agcaccttcccgatctga

DBGET integrated database retrieval system