KEGG   Streptomyces rubrolavendulae: A4G23_03929
Entry
A4G23_03929       CDS       T04616                                 

Gene name
ykoV
Definition
(GenBank) putative DNA repair protein YkoV
  KO
K10979  DNA end-binding protein Ku
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:srn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A4G23_03929 (ykoV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:srn03400]
    A4G23_03929 (ykoV)
DNA repair and recombination proteins [BR:srn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A4G23_03929 (ykoV)
SSDB
Motif
Pfam: Ku HC2
Other DBs
NCBI-ProteinID: AOT61052
UniProt: A0A1D8G6G0
Position
4532782..4534041
AA seq 419 aa
MIPVRKGRTVRSIWNGAISFGLVSIPIKLVNATENRSVSFRQIHTADGGRVRYRKVCELD
GEELPSAEIGKAYEEADGTMIPITDEDLAALPLPTAKTIEIVAFVPASEIDPLQLDAAYY
LAASGVPAAKPYTLLREALKRSERVAIAKFALRGRERLGMLRVVDDVIAMHGLLWPDEIR
QPEGVAPDTAVTVRDAELDLADALMDTLGEVDISTLHDDYREAVEELIAAKAEGAVEVPA
EAKPERGAQVIDLMAALESSVRAAREARGEEAAGEEATGRAAREPAGDQAGRAAGEAAEA
EGGEEGAGGAASVTELRRRTPPKAPAAPKASGGRKSTARTAARTADAAPARKSTAKKTAA
KKAAAKKTAARTTAGTAAKSASKASAKGEGKKAAAARGTSSGATGKTAAKKSTPRRKSA
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgattccggtacgaaagggacgaaccgtgcgatccatctggaacggcgcgatctccttc
gggctggtcagcatccccatcaagctggtgaacgcgaccgagaaccgctccgtctccttc
cgccagatccacaccgccgacggcggccgcgtccggtaccgcaaggtgtgcgagctggac
ggcgaggagctcccgtccgccgagatcggcaaggcgtacgaggaggccgacgggacgatg
atcccgatcaccgacgaggacctggccgcgctgccgctgcccacggccaagacgatcgag
atcgtcgccttcgtgccggcgtcggagatcgacccgctccagctcgacgccgcctactac
ctggcggcgagcggggtgcccgcggcgaagccgtacacgctgctgcgcgaggccctgaag
cgcagcgagcgggtggccatcgccaagttcgcgctgcgcgggcgggagcggctcggcatg
ctgcgggtggtggacgacgtgatcgccatgcacggtctgctgtggccggacgagatccgg
cagccggaaggagtcgcgcccgacaccgccgtcacggtccgggacgccgagctggacctc
gcggacgcgctgatggacacgctcggcgaggtcgacatcagcaccctccacgacgactac
cgggaggcggtcgaggagctgatcgccgccaaggcggagggcgccgtcgaggtgcccgcc
gaggcgaagccggagcggggcgcgcaggtcatcgacctgatggcggcgctggagagcagc
gtacgggcggcccgcgaggcccgtggcgaggaagcggccggcgaggaggccaccggtcgg
gcggcccgggagccggccggggaccaggccgggcgggcggccggggaggccgcggaggcc
gaagggggcgaggagggcgccggcggggcggcgtccgtcacggagctgcgccgccgtacg
ccgccgaaggccccggccgcgcccaaggcgagcggcggccggaagtccacggcccggacc
gccgcgaggacggccgacgcggcaccggcgcgcaagtccacggcgaagaagaccgccgcg
aagaaggccgccgccaagaagacggcggcgaggaccacggccgggacggccgcgaagtcc
gcgtccaaggcgtccgcgaagggggagggcaagaaggccgcagccgcccgcgggacgtcg
tcgggcgccacggggaagaccgccgcgaagaagtccaccccgcgcaggaagtccgcctga

DBGET integrated database retrieval system