KEGG   Streptomyces rubrolavendulae: A4G23_05153Help
Entry
A4G23_05153       CDS       T04616                                 

Definition
(GenBank) D-arabitol-phosphate dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
srn  Streptomyces rubrolavendulae
Pathway
srn00030  Pentose phosphate pathway
srn01100  Metabolic pathways
srn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A4G23_05153
Enzymes [BR:srn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A4G23_05153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AOT62258
UniProt: A0A1D8GA06
Position
complement(6082669..6083727)
Genome map
AA seq 352 aa AA seqDB search
MRALTVRPGPEPSTEVRELGTPVPADGELLVRGVALGVCGTDREIAGGHYGTPPAGRDWM
VAGHESLGRVEEAPPGSGFSPGDLVVGVVRRPDPEPCGACARGLFDMCRNGRYRERGIKE
LDGYGAGYWTVEHDYAVALDPRLEPVGTLLEPASVVAKAWQQVDLVGARSWFEPRRVVVT
GAGPIGLLAALIGVERGLETHVLDRVERGPKPALVRALGAEYHSGDAEDVLDAVRPDVVI
EATGAARVVFAAVSGTRPYGVVCLTGVSPAGRHITVDAGAANRGLVLENDVVVGSVNANV
DHYRQAAAVLARADGAWLERLITRRVPLEGYREAFDAREDDVKVVITLDGAG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctgacggtccggcccggcccggagccctcgacggaggtgcgggagctcggc
acacccgtacccgccgatggggagctgctggtcagaggggtggcgctcggggtgtgcggt
accgaccgggagatcgccgggggccactacggcaccccgcccgcggggcgcgactggatg
gtcgccgggcacgagtcgctcgggcgggtggaggaggcgccgcccggcagcggcttctcc
cccggcgacctcgtcgtcggcgtggtccgccggccggaccccgagccgtgcggagcgtgc
gcgcgcggccttttcgacatgtgccgcaacggccgctaccgcgagcggggcatcaaggaa
ctggacggctacggcgccgggtactggaccgtggagcacgactacgccgtggcgctcgac
ccgcgcctcgaaccggtgggcacgctgctggagccggcctccgtggtcgccaaggcgtgg
cagcaggtggacctggtgggggcgcgttcctggttcgagccgcgccgcgtcgtcgtgacc
ggagccgggccgatcgggctgctcgccgcgctgatcggcgtggagcggggcttggagacc
cacgtgctggaccgggtcgagcggggcccgaagccggcgctcgtccgggcgctcggcgcg
gagtaccacagcggcgacgccgaggacgtgctggacgccgtgcggcccgacgtggtgatc
gaggcgaccggggccgcccgggtggtgttcgccgccgtctcggggacccggccgtacggg
gtggtctgcctgaccggtgtgtcgccggcggggcggcacatcaccgtggacgcgggcgcc
gccaaccggggtctggtcctggagaacgacgtggtcgtcggctccgtgaacgccaacgtc
gaccactaccggcaggccgccgccgtgctggcgcgggccgacggggcgtggctggagcgc
ctgatcacccggcgggtgccgctggaggggtaccgggaggccttcgacgcgcgggaggac
gacgtgaaggtcgtcatcaccctggacggcgccggctga

DBGET integrated database retrieval system