KEGG   Streptosporangium roseum: Sros_0477Help
Entry
Sros_0477         CDS       T01137                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sro  Streptosporangium roseum
Pathway
sro00010  Glycolysis / Gluconeogenesis
sro00620  Pyruvate metabolism
sro00640  Propanoate metabolism
sro00680  Methane metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_0477
   00620 Pyruvate metabolism
    Sros_0477
   00640 Propanoate metabolism
    Sros_0477
  Energy metabolism
   00680 Methane metabolism
    Sros_0477
Enzymes [BR:sro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sros_0477
Lipid biosynthesis proteins [BR:sro01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sros_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACZ83503
UniProt: D2B2M6
Position
complement(476184..478169)
Genome map
AA seq 661 aa AA seqDB search
MAPETPGSESRETQETLSNLLHETRRFAPPADLAAAANVTADAYAEAEQDRLAFWEKQAD
RLTWSKRWDTTLEWNPPFAKWFVGGELNIAYNCVDRHVEAGRGDKVAYHWEGEPEGDSRT
LTYSDLQREVAKAANALQELGVGKGDRVAIYMPMIPELPITMLACARIGAIHSVVFGGFS
AAALSGRIQDADAKVVVTADGGYRRGAPSALKPTVDEALKECPSIEHVLVVRRTGQEVSQ
TEKDVWWHDIVDRQADVHEAQPNDAEDPLYILYTSGTTGRPKGILHTTGGYLTQVAYTHH
AVFDLKPDTDVYWCTADIGWVTGHSYIVYGPLANGATSVIYEGTPDTPHRGRFWEIVQKY
KVTILYTAPTAIRTFMKWGDDIPAKYDMSSLRILGSVGEPINPEAYVWYREHIGKDRAPV
VDTWWQTETGGIMISPLPGVTSGKPGAAMRPLPGISADVVDDQGNTVGNGGGGFLVLREP
WPSMLRTIWGDDQRYIDTYWSRFEGMYFAGDGAKKDEDGDLWLLGRVDDVMLVSGHNIST
TEVESALVSHPKVAEAAVVGATDPVTGQAIVAFVILRGNAEEGADIAAELRNHVAKSLGP
IAKPRQILVVPELPKTRSGKIMRRLLRDVAENRSVGDVTTLADSTVMNLISEKLPSTKSD
D
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
gtggccccggagacccctggttccgagtcgcgtgagacccaggagacgttgtcgaacctg
ctgcatgagacccggcggttcgcacctcctgccgacctggccgcggccgcgaacgtgacc
gccgacgcctacgccgaggcggagcaggaccgcctggcgttctgggagaagcaggccgat
cggctgacctggtccaagcgctgggacaccaccctcgaatggaacccgcccttcgccaag
tggttcgtcggcggagagctcaacatcgcctacaactgcgtcgaccgccacgtcgaggcc
ggtcgcggtgacaaggtcgcctaccactgggagggcgagcccgagggcgacagccgtact
ctcacctattccgacctgcagcgcgaggtcgccaaggccgccaacgcgctgcaggagctc
ggggtcggcaagggcgaccgggtcgccatctacatgccgatgatccccgagctgccgatc
accatgctcgcgtgtgcccgcatcggcgcgatccactccgtggtgttcggcgggttctcc
gccgccgccctcagcggccggatccaggacgccgacgccaaggtcgtggtcaccgccgac
ggcggctaccgccggggcgcgcccagcgcgctcaagccgaccgtggacgaggcgctcaag
gagtgcccgagcatcgagcacgtcctggtcgtcagaaggaccggccaggaggtgtcccag
accgagaaggacgtctggtggcacgacatcgtggaccggcaggcagacgtccacgaggcg
cagccgaacgacgccgaggacccgctctacatcctctacaccagcggcacgaccggcagg
cccaagggcatcctgcacaccaccggcggctacctgacccaggtcgcctacacccaccac
gcggtgttcgacctcaagccggacaccgacgtctactggtgcaccgccgacatcggctgg
gtgaccggtcactcctacatcgtgtacggcccgctggccaacggcgcgaccagtgtcatc
tacgagggcaccccggacaccccgcaccggggccggttctgggagatcgtgcagaagtac
aaggtcacgatcctctacaccgccccgacggcgatccgcaccttcatgaagtggggcgac
gacatccccgccaagtacgacatgtcgtccctgcgcatcctgggcagcgtcggcgagccg
atcaaccccgaggcctacgtctggtaccgcgagcacatcggcaaggaccgtgctccggtg
gtggacacctggtggcagaccgagaccggcggcatcatgatcagcccgctgcccggcgtc
acctcgggcaagcccggcgcggccatgcgcccgctgcccggtatcagcgccgacgtggtc
gacgaccagggcaacaccgtcggcaacggcggcggcggcttcctggtgctgcgcgagccg
tggccgtccatgctccgcacgatctggggcgacgaccagcgctacatcgacacctactgg
tcccgcttcgagggcatgtacttcgccggcgacggcgccaagaaggacgaggacggcgac
ctgtggctgctgggccgcgtggacgacgtcatgctcgtctccggccacaacatctccacc
accgaggtggagtcggccctggtctcccacccgaaggtcgccgaggccgccgtggtcggc
gcgaccgatcccgtgaccggccaggccatcgtggccttcgtgatcctgcgcggcaatgcc
gaggagggcgccgacatcgccgccgagctccgcaaccacgtggccaagtccctgggaccg
atcgccaagccgcgccagatcctggtggtccccgagctgccgaagacccgctcgggcaag
atcatgcgacgcctcctgcgcgacgtggcggagaaccgcagcgtcggcgacgtcaccacg
ctggccgacagcacggtgatgaacctcatctccgagaagctgcccagcaccaagagcgac
gactga

DBGET integrated database retrieval system