KEGG   Streptosporangium roseum: Sros_2261Help
Entry
Sros_2261         CDS       T01137                                 

Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sro  Streptosporangium roseum
Pathway
sro00620  Pyruvate metabolism
sro00630  Glyoxylate and dicarboxylate metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01200  Carbon metabolism
Module
sro_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sros_2261
   00630 Glyoxylate and dicarboxylate metabolism
    Sros_2261
Enzymes [BR:sro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sros_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACZ85243
UniProt: D2AZJ8
Position
complement(2443520..2445106)
Genome map
AA seq 528 aa AA seqDB search
MDGVEITGPSQDRSDEILTPEALAFVAALQREFGARRLELLEARRERQAELSAGGTLDFL
PETKHVRESEWRVAPPAPGLEDRRVEITGPVDRKMTINALNSGAKVWLADFEDANAPTWE
NTINGQLNLRDALDRTIDFSAGEKHYALKPDEELATIVVRPRGWHLEEKHLTLDGAPFSA
SLVDFGLYFFHSARRQIAKGRGPYFYLPKMESHLEARLWNDVFVRAQDLLGIPQGTIRAT
VLIETYPAAFEMEEILHELREHSAGLNAGRWDYLFSVIKKFRTRGREFLLPERNAVTMTA
PFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDPEVNKVALEKVTADKTRESGDGFDGS
WVAHPDLVPICRDVFDGVLGDRPNQLDRLREDVSVSAADLLSVSETPGDITEAGLRNNVD
VALRYLAAWMGGLGAVAIHNLMEDAATAEISRSQIWQWIHNDIELADTGAVVTKELVERI
IDEELAKIKAEPGYDEALYAQATALFKEVALDDDFAEFLTLPAYARMP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgttgagatcaccggcccctcgcaggaccggtcagacgagatcctcacgccg
gaggccctggccttcgtggccgccctccagcgcgagttcggcgcccggcgccttgagctg
ctggaggcgcgccgggaacgccaggcggagctgtcggcgggcggcaccctcgacttcctg
cccgagaccaagcacgtgcgcgagtccgagtggcgggtcgccccgcccgcgcccggcctg
gaggaccgccgcgtggagatcaccggcccggtggaccggaagatgacgatcaacgcgctg
aactccggcgccaaggtctggctggccgacttcgaggacgccaacgcccccacctgggaa
aacaccatcaacggccagctcaacctgcgggacgcgctggaccggaccatcgacttctcg
gccggggagaagcactacgcgctcaagcccgacgaggagctcgccaccatcgtggtccgc
ccgcgcggctggcacctggaggagaagcacctcaccctcgacggcgcccccttctccgcc
tcgctcgtcgacttcggcctctacttcttccactccgcgcggcggcagatcgccaagggc
aggggcccctacttctacctgccgaagatggagtcgcacctggaggcccgcctctggaac
gacgtcttcgtcagggctcaggacctgctcggcatcccgcagggcacgatccgcgcgacc
gtcctgatcgagacctaccccgcggcgttcgagatggaggagatcctccacgagctccgc
gagcactccgcgggtctcaacgccggacgctgggactacctgttcagcgtgatcaagaag
ttccgcacccggggccgggagttcctgctgcccgagcggaacgcggtcaccatgaccgcc
cccttcatgcgcgcctacaccgagctgctggtccgcacctgccacaagcgcggcgcccac
gccatcggcggcatggccgcgttcatcccctcccgccgcgacccggaggtcaacaaggtc
gccctggagaaggtcaccgccgacaagacccgcgagtccggcgacggcttcgacggctcc
tgggtggcccaccccgacctggtcccgatctgccgcgacgtcttcgacggtgtcctcggc
gaccggccgaaccagctcgaccgcctgcgagaggacgtctcggtctccgccgccgacctg
ctgtcggtctccgagaccccgggcgacatcaccgaggcgggcctgcgcaacaacgtggac
gtggccctgcgctacctggccgcctggatgggcgggctgggcgcggtggcgatccacaac
ctgatggaggacgccgccaccgccgagatctcccgctcccagatctggcagtggatccac
aacgacatcgagctcgccgacaccggggccgtggtcacgaaagagctcgtcgagcggatc
atcgacgaggagctcgccaagatcaaggcggagcccggctacgacgaggccctctacgcc
caggccaccgccctgttcaaggaggtcgccctcgacgacgacttcgcggagttcctcacc
cttcccgcctacgcgcgcatgccgtga

DBGET integrated database retrieval system