KEGG   Streptosporangium roseum: Sros_4103Help
Entry
Sros_4103         CDS       T01137                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sro  Streptosporangium roseum
Pathway
sro00010  Glycolysis / Gluconeogenesis
sro00071  Fatty acid degradation
sro00350  Tyrosine metabolism
sro00625  Chloroalkane and chloroalkene degradation
sro00626  Naphthalene degradation
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01120  Microbial metabolism in diverse environments
sro01130  Biosynthesis of antibiotics
sro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sros_4103
  Lipid metabolism
   00071 Fatty acid degradation
    Sros_4103
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sros_4103
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sros_4103
   00626 Naphthalene degradation
    Sros_4103
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sros_4103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ACZ87011
UniProt: D2AWL5
Position
complement(4562125..4563123)
Genome map
AA seq 332 aa AA seqDB search
MDAWVVARPGPITSRPLERTRLPVPSPGPGEVLVEVEACAVCRTDLHLAEGDLPPRRPGT
VPGHEVVGRVAASGPDTVRLAPGTRVGVAWLRSTCGRCRYCRRGAENLCPASTYTGWDVD
GGYAGYLTAPEDYVYPLPEDPPAEKLAPLLCAGIIGYRALLRCDLPAGGRLGIYGFGASA
HLTAQIAIAQGATVHVLTRSAGARELAMTLGAASAGGAADAPPEPLDAAILFAPAGELVP
VALAALDRGGTLAVAGIHLSDIPALDYRRHLFQERTLRSVTANTRADGRAYLELATAHPP
RVATVAYPFDAADRALDDLAAGRVEGAAVLVR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctgggtggtcgcccgtcccggcccgatcacctcgcgcccccttgaacggacc
aggctcccggtcccctcgccgggtcccggcgaggtgctcgtcgaggtggaggcgtgcgcg
gtgtgccgcaccgacctccatctggccgagggcgacctgcccccgcgccgtcccgggacc
gtgcccggtcacgaggtcgtcggccgcgtggcggcgagcggcccggacacggtacggctc
gcgcccggcacccgggtgggcgtggcctggctccgctcgacgtgcgggcgctgccgctac
tgccgccggggcgcggagaacctctgccccgcctccacctacaccggctgggacgtcgac
ggcggctacgccggatatctcaccgcccccgaggactacgtctacccgctccccgaggac
ccgccggccgagaagctggctcccctgctgtgcgccgggatcatcggataccgcgccctg
ctccgctgcgacctgcccgccggcggccgcctgggcatatacggcttcggcgcctcggcc
cacctgaccgcccagatcgccatcgcccagggcgcgaccgtgcacgtcctcacccggtcg
gccggagcgcgtgagctggccatgaccctgggagcggcctccgccggcggtgcggccgac
gccccgcccgaaccgctggacgccgcgatcctgttcgcaccggccggcgagctggtgccc
gtcgcgctggccgccctggaccggggcggcaccctcgccgtggcgggcatccacctcagt
gacatcccggcgctggactaccggcggcacctgttccaggagcggacgctgcgcagtgtc
accgccaacacccgcgccgacggccgggcgtatttggagctcgccaccgcgcatcccccg
cgtgtcgcgaccgtcgcctaccccttcgacgcggcggaccgggcgctggacgacctggcc
gcgggccgcgtcgaaggcgccgccgtgctcgtcaggtag

DBGET integrated database retrieval system