KEGG   Streptosporangium roseum: Sros_4954Help
Entry
Sros_4954         CDS       T01137                                 

Definition
(GenBank) Tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sro  Streptosporangium roseum
Pathway
sro00260  Glycine, serine and threonine metabolism
sro00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
sro01130  Biosynthesis of antibiotics
sro01230  Biosynthesis of amino acids
Module
sro_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sro00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sros_4954
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sros_4954
Enzymes [BR:sro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sros_4954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB
Motif
Other DBs
NCBI-ProteinID: ACZ87759
UniProt: D2B8E9
Position
5481213..5481998
Genome map
AA seq 261 aa AA seqDB search
MTDSLEEFLIARRGTGRPLLVPYVTAGVTPGWTDVVHAYADAGADAVELGFPFSDPMLDG
VTIQEASDRAIAAGTTVKGILEEVATLDVDVPLIAMTYSNLVVQQSTAEFCAALTAGGLR
GLIVPDSPLEEVGELADAAAAEGLHLVLLAAPSSSRARLREIAERSRGFVYALTRMGTTG
EHSEVPEQAARLGRELKGLTDRPVLFGFGVSNPAQAAELAGHADGVVVASALMRKLLDGA
RPRELGEYVASIRRALDQGAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgattccctggaagaattcctgatcgcacgccgtggcacgggacgtcccctgctg
gtgccctatgtcaccgccggggtcacccccggatggacggacgtcgtccacgcctacgcc
gacgccggagccgacgccgtcgagctgggcttccccttctccgatcccatgctggacggc
gtcacgatccaggaggcctccgaccgggcgatcgcggccgggaccacggtcaaggggatc
ctcgaggaggtcgcgacgctcgacgtcgacgtgccgctcatcgcgatgacctacagcaat
ctggtggtgcagcagagcaccgcagagttctgtgcggcgctcaccgcgggcggactgcgc
gggctgatcgtgcccgactcgcccctggaggaggtcggggagctggcggacgccgcggcg
gccgagggcctgcatctcgtactgctcgccgctccctcctcctcccgggccagactgcgc
gagatcgccgagcgcagccggggcttcgtctacgccctgacccgcatgggcaccaccggc
gagcacagcgaggttcccgagcaggccgcccggctcggccgcgagctcaagggactcacc
gaccggccggtcctgttcggtttcggggtctccaacccggcgcaggccgccgagctggcg
ggtcatgccgacggcgtcgtggtggcttcggcgctgatgcgcaagctcctcgacggcgcc
cggccacgcgagctgggagaatatgtggcgagcattcgacgcgcactcgaccagggagcc
agatga

DBGET integrated database retrieval system