KEGG   Streptosporangium roseum: Sros_6143Help
Entry
Sros_6143         CDS       T01137                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
sro  Streptosporangium roseum
Pathway
sro00460  Cyanoamino acid metabolism
sro00500  Starch and sucrose metabolism
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sros_6143
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Sros_6143
Enzymes [BR:sro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Sros_6143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ACZ88873
UniProt: D2AWU5
Position
complement(6738104..6740185)
Genome map
AA seq 693 aa AA seqDB search
MPDLRHVPRALAVAAVLAAALLRPPATAAGEGPGHPWLDPARPVAERVELLLGAMTQDEK
LNMVRGHGLGLIPRGRVAPVPRLGIPELRMHDGPHGVSDVSGVTAFPAPVTLAATWDTSL
ARRFGAALGAEARGKGVNVHLAPAVDILRVPQSGRAWESFGEDPYLASAMAGEEVAGIRG
QNVIAAVKHYVGNNQETDRMRVDAVIDERTLREIYYPPFEAAVTAGAGAVMCAYNRVNGP
FACENPQTLTAALKDSMGFGGWVMSDWLATRSGQKAALAGLDQAMPDDPLFAANLKVGIA
LGTFPAARLDDMARRVLTPMFADGLFETGYGAPDRDVRTPEHTALARDIAVSGTVLLKNR
DGILPLTGGRIAVIGTAAHDNVEITSAGSGRVLPPYVVTPYQGLDARAGGTATYSPGDAE
GALPWDVDKRLRDAADAARRADVAVVVVGLSSQEGEDRPDLGLPGNMETLIETVAAANPR
TVVVLTSPAQVLMPWAGRVKGVVSAFIGGQELGNALAAVLYGDADPGGRLPMTFAARAAD
YPASTPEQFPGVGHRQVYSERLRVGYRHFDATGLTPLFPFGHGLSYTSFSYDSLSISGAT
VRARVTNTGSRAGVAVPQLYLGFPPEAGEPPRQLRGFARLRLAPGESATVAFRLPERAFQ
VWTSQGWSTVRGDHTVQVGASSRDLPLSGTLTR
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacctccgtcacgttccccgagcgctcgcggtggccgcggtcctggcggccgcg
ctgctgcgtccccccgcgacggccgccggcgaaggccccggccacccctggctggacccc
gccaggcccgtcgcagagcgcgtggagctcctgctcggcgcgatgacgcaggacgagaag
ctgaacatggtccgcgggcacggcctcgggctgatcccccggggacgggtggcgcccgtt
ccccgcctgggcatccccgagctccgcatgcacgacggcccgcacggcgtgagcgacgtg
agcggtgtgaccgccttccccgcgccggtcaccctggccgccacctgggacacctccctc
gcccgccggttcggggccgcgctcggcgccgaggcgaggggcaagggcgtcaacgtccac
ctcgcccccgccgtggacatcctgcgggtgccgcagtcgggaagggcctgggagagcttc
ggggaggacccctatctcgcctccgcgatggcgggggaggaggtcgccgggatccggggg
cagaacgtcatcgccgccgtcaagcactacgtcggcaacaaccaggagaccgaccgcatg
cgggtcgacgccgtgatcgacgagcggacgctgcgggagatctactacccgcccttcgag
gccgccgtcaccgccggggccggcgcggtcatgtgcgcctacaacagggtcaacggcccg
ttcgcctgcgagaacccccagacgctcaccgccgctctgaaggactccatgggcttcggg
ggctgggtcatgtccgactggctggccacccggagcgggcagaaggccgccctggccggc
ctggaccaggcgatgccggacgacccgctgttcgccgcgaacctcaaggtggggatcgcc
ctggggacgttccccgccgcgcggctcgacgacatggcccggcgcgtgctcacgccgatg
ttcgccgacgggctcttcgagaccgggtacggcgcgccggaccgggacgtccgcaccccc
gagcacaccgccctggcccgcgacatcgcggtctccggcaccgtcctgctcaagaaccga
gacgggatcctgccgctcaccggcggccggatcgccgtcatcgggaccgccgcgcacgac
aacgtcgagatcacctccgccggctccggccgggtgctgccgccctacgtggtcacgccg
taccagggcctcgacgccagggccggaggcaccgcgacctactcgccgggagacgcggag
ggggcgctgccctgggatgtcgacaagcggctgcgcgacgccgccgacgcggcccggcgg
gccgacgtcgccgtggtcgtggtgggcctgtcctcccaggagggggaggacaggccggac
ctcgggctgccgggcaacatggagacgctgatcgagaccgtcgccgcggccaatccgcgt
acggtcgtcgtgctgacctcccccgcgcaggtcctcatgccctgggccggccgggtcaag
ggcgtggtctcggccttcatcggggggcaggagctcggcaacgcgctcgcggccgtgctg
tacggcgacgccgaccccggcggtcgcctgccgatgacgttcgccgcccgtgccgccgac
tacccggcgagcactcccgagcagtttcccggggtcggtcaccggcaggtctacagcgag
cggctgcgggtcggctaccggcacttcgacgcgaccggcctcacgccgctgttccccttc
gggcacggcctgtcctacacgagcttctcctacgactccctgtcgatctccggggccacg
gtgcgggccagggtgaccaacacgggctcacgcgcgggcgtcgccgtaccgcagctgtat
ctcgggttcccgccggaggcgggagagccgccccggcagctccgcgggttcgccaggctc
cggctcgcgccgggggagtcggcgaccgtcgccttccggctcccggagcgggcctttcag
gtctggacgtcccaggggtggagtaccgtgcgcggcgaccacaccgtccaggtgggcgcc
tcctcgcgggatctccccctcagcgggacgttgacccgctga

DBGET integrated database retrieval system