KEGG   Spiribacter roseus: BBH56_07240Help
Entry
BBH56_07240       CDS       T06143                                 

Definition
(GenBank) apolipoprotein acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sros  Spiribacter roseus
Brite
KEGG Orthology (KO) [BR:sros00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBH56_07240
Enzymes [BR:sros01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BBH56_07240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Chalcone
Motif
Other DBs
NCBI-ProteinID: AUB78908
Position
complement(1473907..1474728)
Genome map
AA seq 273 aa AA seqDB search
MSGPVRAAVVQMVSGMEVASNLTAAGGLIGQAVGHGARLVVLPENFAFLGRHQRDVLGVA
ESPGEGPIQSFLAQTAQHHGITLVGGSVPLQGDESDRVRAASLVFGPDGDCLARYDKRHL
FDVSLPGGEVYRESSTLAPGDAVVVAETPAGMLGLSICYDLRFPEHYRALVDGGATILLA
PSAFTATTGAAHWSVLVRARAIENGCYVLAPDQGGLHANERMTHGESLIVDPWGACLANA
GIGSGPGIAVADLDPAHQQAIRERLPSLSHRRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaccggtccgtgcggcggtggtgcagatggtctcgggtatggaggtggccagc
aacttgaccgcggccggcggtctgatcggccaggcggtaggccacggcgcccgcctggtg
gtgctgcccgagaacttcgcctttctgggccgtcaccagcgggacgttctgggtgtggcg
gagtcgcccggtgaggggccgatccagagttttctcgcacagaccgcccagcaccacggc
atcaccctggtgggcggcagtgtgccgctgcagggcgatgaatccgaccgggtccgggcc
gcctcgctggtgttcggtccggatggcgattgcctggcccgctatgacaagcgccacctg
tttgatgtctccctgccggggggcgaggtttaccgcgagtcatccaccctcgcgcccggc
gacgcggtggtggtggcggaaacgcctgcgggaatgctcggcctgtcgatctgttatgac
ctgcgcttccccgaacactatcgggccctggtggatggcggcgcgacgatcctgctggcc
ccctcggcgttcacggccaccaccggtgccgcgcactggtcggtgctggtgcgcgcgcgg
gcgatagagaacggttgttacgtcctcgccccggatcagggtgggttgcatgccaacgag
cgcatgacccacggcgagagcctgatcgtcgatccctggggggcgtgcctggcgaatgcc
ggtatcggcagtggccccggtattgccgtggccgacctggatccggctcatcagcaggcc
atccgcgagcggttgccatcgctttcccatcgacgtggctga

DBGET integrated database retrieval system