KEGG   Streptococcus ruminantium: SR187_2505Help
Entry
SR187_2505        CDS       T05916                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
srq  Streptococcus ruminantium
Pathway
srq00071  Fatty acid degradation
srq00072  Synthesis and degradation of ketone bodies
srq00280  Valine, leucine and isoleucine degradation
srq00310  Lysine degradation
srq00362  Benzoate degradation
srq00380  Tryptophan metabolism
srq00620  Pyruvate metabolism
srq00630  Glyoxylate and dicarboxylate metabolism
srq00640  Propanoate metabolism
srq00650  Butanoate metabolism
srq00900  Terpenoid backbone biosynthesis
srq01100  Metabolic pathways
srq01110  Biosynthesis of secondary metabolites
srq01120  Microbial metabolism in diverse environments
srq01130  Biosynthesis of antibiotics
srq01200  Carbon metabolism
srq01212  Fatty acid metabolism
srq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:srq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SR187_2505
   00630 Glyoxylate and dicarboxylate metabolism
    SR187_2505
   00640 Propanoate metabolism
    SR187_2505
   00650 Butanoate metabolism
    SR187_2505
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SR187_2505
   00072 Synthesis and degradation of ketone bodies
    SR187_2505
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SR187_2505
   00310 Lysine degradation
    SR187_2505
   00380 Tryptophan metabolism
    SR187_2505
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SR187_2505
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SR187_2505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SR187_2505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srq04147]
    SR187_2505
Enzymes [BR:srq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SR187_2505
Exosome [BR:srq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SR187_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BBA92110
UniProt: A0A2Z5TL83
Position
complement(475266..476456)
Genome map
AA seq 396 aa AA seqDB search
MKKVTIVSAYRSAIGSFGGSLKDIEIAELGAQILRAALTNKHIPTDCVDEVIFGNVLSSG
QGQNIARQIALRAGLPQTTPAYAVNKVCGSGLKSILLATQSILVGDNDVVVAGGIEIMSQ
APYLSKNSRFGGKLGHLNLEDSILTDGLTDAFHRYHMGITAENIAEQYHIGRKEQDAFAY
ASQKKAAKAISEGRFKDEIVPIPLVSRKGETIFDTDEYPRLTSLEKLATLRPAFKDGGTV
TAGNASGINDGCAVLVLMSEDKANELNIQPLAYIESYATSGLDPAYMGLGPITASQKALE
KIGKSIEEIDLFEFNEAFAAQSLPIIAELGVNPEKVNVNGGAIALGHPIGASGSRILVTL
IHELTKQEKKLGLCALCIGGGQGISLIISNAQISYP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtaactatcgtgtctgcctaccgttctgccattggcagcttcggaggcagt
ctgaaagatattgaaattgctgagttaggtgcacagatcctaagggcagccttaacaaac
aaacatataccgacagattgcgtagatgaagttatcttcggaaatgttctctcatctgga
cagggacaaaatatcgcccgacagattgctttgcgtgccggacttccacaaacaactcct
gcttacgcagtcaataaggtctgtggatctggactaaaatctatcttactagcaacccaa
tccatcctcgttggcgataatgatgtcgtagtggctggcggaatcgagatcatgagccaa
gctccctacctatcaaaaaacagtcgtttcggtggcaagcttggacatctcaatttggaa
gattccattttaacagatggtttgactgatgcatttcatcgctatcacatgggtatcact
gccgagaatattgctgaacaataccacattggtcgcaaggaacaagatgcatttgcctac
gctagccagaaaaaagctgccaaagctatttcagaaggacgcttcaaggatgagattgtt
cctatccctctagtctctagaaaaggagaaacaatttttgatacagacgaatatcctcgc
ctaacgtcacttgaaaaactagcaacactacgacctgcttttaaagatggcggaacagtc
actgccgggaatgcttctggtatcaacgatggttgtgctgttttggttctcatgtctgag
gacaaggccaatgaactcaacatacagcctcttgcttacatagaatcttatgcaaccagt
ggcttagaccctgcttatatgggacttggtcccattactgcgagtcaaaaagcacttgaa
aaaattggaaaatcaattgaagagattgacctatttgagtttaatgaagccttcgctgcc
caatcactcccaatcatagctgaactaggggttaaccctgaaaaagtcaatgtcaatggc
ggagctattgctcttggtcatcccattggagccagtggaagtagaatcttggtcaccttg
attcatgaattaaccaagcaagaaaagaaactcggtctctgtgccctctgcattggaggt
ggtcaaggtatctcacttatcatctccaatgcacaaataagctacccctaa

DBGET integrated database retrieval system