KEGG   Streptococcus ruminantium: SR187_3260Help
Entry
SR187_3260        CDS       T05916                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
srq  Streptococcus ruminantium
Pathway
srq00450  Selenocompound metabolism
srq00970  Aminoacyl-tRNA biosynthesis
srq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SR187_3260
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SR187_3260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:srq01007]
    SR187_3260
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:srq03016]
    SR187_3260
Enzymes [BR:srq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SR187_3260
Amino acid related enzymes [BR:srq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SR187_3260
Transfer RNA biogenesis [BR:srq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SR187_3260
 Prokaryotic type
   Other AARSs
    SR187_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: BBA92261
UniProt: A0A2Z5TY38
Position
644708..646711
Genome map
AA seq 667 aa AA seqDB search
MTKRPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHAVFYLTGLDEHGQKIETK
AAEAGLSPQSYVDGMAEGVKELWKLLDISYDKFIRTTDDYHEKVVADVFERLLAQDDIYL
GEYSGWYSVSDEEFFTESQLAEVFRDESGKVTGGIAPSGHEVAWVSEESYFLRLSKYQDK
LVEFFEKHPDFIQPDGRLNEIMKNFIEPGLEDLAVSRTTFSWGVPVLSDPKHVVYVWIDA
LLNYATALGYGQDDHANYDKFWNGTVFHMVGKDILRFHSIYWPVLLMMLDMKLPDRLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVAMINKYFGGSLPNFKAGVTAFDADLEEMAEQSIQDYHKHMESVDYPR
ALETVWNLIARTNKYIDETAPWILAKEDGDKEQLASVMAHLAASLRVVAHLIQPFMMATS
HAIMEQLGMGNVTSLETLKFADLPNDLTVIAKGTPIFPRLDMEEEIAYIKAQMGGSSAIS
QEEKKDWDPASVELKNQKETIQFEDFDKVEIRVAEVKEVSKVKGSDKLLKFRLDAGDGED
RQILSGIAKYYPNEQELVGKKVQIVANLKPRKMMGLLSQGMILSAEYNDHLTLLTVDSSV
PNGSQIG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagaccattttacattacaacgccgatttactatccatccggcaagctccac
attggctctgcctacacgactattgcctgtgatgttttagctcgttataagcgcttgatg
ggtcatgcagtcttctacttgaccggtcttgatgagcatggtcaaaaaatagaaaccaag
gctgctgaggccggtttgagtccgcagtcttatgttgatggcatggcagagggtgttaag
gaactttggaagctccttgatatttcctatgacaaatttatccgtacaacagatgattac
catgaaaaagttgttgcagacgtttttgagcgattgctggcacaagatgatatttacttg
ggtgagtactcaggctggtattctgtatcagacgaagaatttttcactgaaagccaatta
gcagaggtctttcgagatgaatccggcaaggtaacaggtggtattgctccgagcggccat
gaggtagcctgggtatcagaagagtcttacttcctccgccttagcaagtatcaagataag
ctagtagagttctttgagaagcatccagactttatccagcctgatggtcgtctcaatgaa
atcatgaagaactttatcgagccaggtctggaagatttggctgtttcccgaacgaccttc
agttggggagtgccagtgctgagcgaccctaagcatgtagtctatgtttggattgatgcc
ctgctcaactatgcgactgcccttggctatggtcaggacgaccacgccaactacgataag
ttctggaatggtacggtcttccatatggttggtaaggatattctccgtttccactctatc
tactggccagtcctcctgatgatgttggatatgaagttacccgatcgtttgattgctcac
ggttggttcgtcatgaaagatggcaagatgtctaagtccaaaggcaatgtggtttatcca
gaaatgttggttgagcgctttggtcttgaccccctccgctactacctcatgcgcagttta
cctgtcggatctgacgggactttcacgcctgaggactatgttggtcgaatcaattatgaa
ctagcaaatgacctcggcaatctcctcaatcgtacggttgccatgattaacaagtacttc
ggtggtagcctgcctaacttcaaggctggtgtaacagcttttgatgctgatttggaagaa
atggcagagcagtctatccaagactatcataaacacatggaatctgttgattatccacgt
gcccttgagacagtttggaatttgattgcccgcaccaacaagtacattgatgaaacagcc
ccttggatcctagctaaagaagacggcgataaggaacaactggctagtgtcatggcacat
ttggcggcaagtcttcgtgtggtggcgcacctcattcaaccatttatgatggcgacgtca
catgcaatcatggaacaactaggcatgggtaatgtgacctcgcttgaaactcttaaattt
gctgatcttccaaatgacttgacagtgattgccaaggggactcctatctttccacgtctt
gatatggaagaagaaatcgcctatatcaaagctcaaatgggtggaagctctgctatttcc
caagaggagaaaaaagactgggatccagctagcgtggaactcaaaaatcagaaagaaacg
atccaatttgaagactttgacaaggtagaaatccgcgtagcagaggtcaaagaagtttca
aaagttaagggctcagataaattgcttaaattccgcctagatgctggtgacggtgaagat
cgccaaatcctgtctggtattgccaaatattatccaaatgagcaagaattggtcggtaaa
aaagttcaaatcgtagctaacctaaagccgcgcaagatgatgggcttgctcagtcaaggg
atgatcctttcagcagagtacaatgatcatttaacccttttgacagtggattcatctgta
ccaaatggcagtcaaattggataa

DBGET integrated database retrieval system