KEGG   Streptococcus ruminantium: SR187_6510Help
Entry
SR187_6510        CDS       T05916                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
srq  Streptococcus ruminantium
Brite
KEGG Orthology (KO) [BR:srq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:srq03009]
    SR187_6510
Enzymes [BR:srq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     SR187_6510
Ribosome biogenesis [BR:srq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SR187_6510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS Methyltransf_23 Ubie_methyltran Methyltransf_32 CMAS FtsJ Methyltransf_9 NodS ADH_zinc_N tRNA_U5-meth_tr zf-Di19
Motif
Other DBs
NCBI-ProteinID: BBA92907
UniProt: A0A2Z5TNZ5
Position
complement(1345012..1345860)
Genome map
AA seq 282 aa AA seqDB search
MMKHQRFTNSDQFFACPYCRQVLGLDQNSLRCSNRHTFDIAKQGYVNLAPQVKQSANYHK
SNFENRQSFLEQGYYDHLYQVLEGKIAELRLQSVLDIGCGEGFYSRKLAQKMNLDILAFD
ISKDSVLLAARTDSTKAVKWFVGDLTKLPIQDKTIDGILDIFSPANYQEFTRVLKEGGTV
FKLVPGPNHLKELRHLAQKQLRKESYDNREIVDYFKSYMGQIEEILVSRTLPISQAHAQV
LADMTPLFFQVDQSQLDLSQLKEITIEGLLLVGKIETLSSNN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacaccaacgttttacaaatagcgatcaattttttgcctgcccatactgtagg
caggttcttggtcttgatcaaaatagcctacgctgttcaaatcgacatacctttgatatt
gccaaacaggggtatgtcaacctagcacctcaggttaaacagtctgctaattatcataaa
tctaactttgaaaaccgccaatcttttttggaacaaggatattatgatcatctctatcag
gttcttgaagggaaaatagctgagttgcgcttacaatcagtcttagacatcggctgtggg
gaaggattttattctcgtaagttggctcagaaaatgaacttggatattcttgcttttgat
atttctaaggattccgtcttgttggcagcacgcacagatagtacaaaggcagtcaaatgg
tttgtcggggatttgaccaagttacctatacaagataagactattgatgggattttggat
attttttctcccgccaattatcaggaatttaccagagtacttaaagaaggtggaactgtt
ttcaaactggttccgggtccaaaccatctcaaggagcttcgccatttagcccaaaaacag
ttacgcaaggagtcttatgacaaccgtgagattgtggattatttcaagtcatacatgggg
cagattgaggagattttagtcagtcgcacgttgccaatcagtcaagcccatgctcaagtg
ttggcagatatgacgccactcttttttcaagtggatcagtcccagctagatctcagccag
ttgaaggaaattaccattgaaggtttgctcttagtgggaaaaatagagacattgagttct
aataactag

DBGET integrated database retrieval system