KEGG   Serratia plymuthica AS9: SerAS9_0291
Entry
SerAS9_0291       CDS       T01503                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4704 family
Organism
srr  Serratia plymuthica AS9
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: AEF43453
Position
337746..338657
AA seq 303 aa
MMKARVLALSLSVLPLAAMFTVPVAQSEELMKWERIPLQIPLAVGKERVLFADKNVRVGF
PPALNGKLRVQSSGGAVYLKADAAFPPTRLQLQDVENGGVILLDVTASDKGSAEPVRIVY
SGDVSSISSSNDTATSSAGSPSAAPGAEDGTQAKRKKIRYNAPLPVVLTRYAAQSLYGPV
RTVEAVPGIHPVNPHLPKRITTLYPSEPVAITLLGGWGIGSRNVVALKVQNTASRKIILD
PRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGAFVAEPSGVRKAVKAAKKGA
NHG
NT seq 912 nt   +upstreamnt  +downstreamnt
atgatgaaagcacgcgttcttgcgctttccctgagtgtgcttcccctggcggcgatgttc
accgtaccggtagcccagtcggaagagctgatgaaatgggagcgtatcccgctgcaaatc
ccgctggccgtcggcaaggagcgggtgctgtttgccgataaaaatgttcgcgtcggtttc
ccgccggcactgaacggcaagctgcgggtgcaaagcagtggcggggctgtttatctgaaa
gccgatgccgcatttccgccaacgcgtctgcaactgcaggacgtcgaaaacgggggggtt
attctcctcgatgtgacggcatcggacaaaggctccgccgagccggtgcgtattgtctac
agcggtgatgtgtcgtcgatcagtagcagtaatgataccgcgacctcgtcagccgggagc
ccttcggcagcgcctggggcggaagacggcacccaggcgaagcgtaaaaaaatcagatac
aacgccccgctgccggtggtgctgacacgctatgcggcacaaagcctgtacggtccggtg
cgcacggttgaggcggtgcccggcattcacccggtcaacccgcacctgccgaaacgtatc
accacactgtacccgtcagagccggtggccatcaccctgctgggcggctggggtattggc
agtcgtaacgttgtggcgctaaaagtgcagaacaccgccagtcgcaaaatcatcctggat
ccgcgggtactgcaggggcagttcgtgacggccaccttccagcaccgttatctggggccg
gtgggtaccccggaggacactaccacgctgtacctggtcaccgccggtcgcccggatggg
gcgtttgtcgcggagccgtcgggggttcgcaaagcggtgaaggcagcgaagaagggggca
aaccatggctga

DBGET integrated database retrieval system