KEGG   Serratia plymuthica AS9: SerAS9_0892Help
Entry
SerAS9_0892       CDS       T01503                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00330  Arginine and proline metabolism
srr00332  Carbapenem biosynthesis
srr01100  Metabolic pathways
srr01130  Biosynthesis of antibiotics
srr01230  Biosynthesis of amino acids
Module
srr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SerAS9_0892
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SerAS9_0892
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SerAS9_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEF44044
Position
990446..991549
Genome map
AA seq 367 aa AA seqDB search
MNGSQTLVVKLGTSVLTGGSLRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRERFLNARDT
MTALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLYTADPR
NNPQAELIREVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDVIIAAGSKPG
VVGDVIEGKPVGTRFHALETPLENRKRWIFGAPPAGEITVDDGAVEAIMARGSSLLPKGV
REVKGDFSRGEVIRIRNLAGRDLAHGVSRYNSDAMRMIAGHHSQEISEILGYEYGPVVVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagccagacattggttgtgaaattgggcaccagcgtgttgaccggcggatcg
ctgcgtcttaaccgtgcccatattgtcgaactggtacgccagtgcgcacaacagcatgca
gcgggtcaccgcatcgttattgtcacctctggcgcgattgccgccgggcgcgaacatttg
ggctaccccgaactccccgccaccatcgcctccaagcagctgcttgcggcggtcggccag
agccggttgatccaactgtgggaacagctgttctccatttatggcatccacgtcgggcag
atgctgctgacgcgcgccgatctggaagaccgcgaacgcttcctcaacgcgcgtgacacc
atgaccgcgctgctggacaaccgtatcgtgccggtaatcaatgagaatgacgcggtagcg
accgcagaaatcaaggtgggcgacaacgacaacctgtcggcgctggcggcgatcctggcc
ggggccgacaaactgctgctgctgaccgatcaacaaggcctgtataccgccgacccgcgc
aacaacccgcaggcggaactgatccgcgaagtgcatggcattgacgacgcgctgcgcgcc
atcgccggcgacagcgtttccgggttgggcacaggcggcatgggcaccaaattgcaggcg
gccgacgtggcctgccgcgccggtatcgacgtgatcatcgccgcaggcagcaagccgggc
gtggtgggcgacgtgattgaaggcaaaccggtgggcacccgtttccacgcgctggaaacc
ccgctggaaaaccgcaaacgctggatcttcggcgcaccgccggccggtgaaatcaccgtg
gacgacggcgcggtcgaggccattatggcgcgcggcagctcgttgctgccgaagggcgtt
cgcgaagtgaagggcgatttctctcgtggcgaagtgatccgcatccgcaacctggcgggg
cgcgatttggcgcacggcgtcagccgctataacagcgacgcgatgcgcatgattgccggc
caccactcgcaggaaatcagcgaaattctcggttacgaatacggcccggtggtagtgcac
cgcgacgacatgattgtgagctaa

DBGET integrated database retrieval system