KEGG   Serratia plymuthica AS9: SerAS9_1194Help
Entry
SerAS9_1194       CDS       T01503                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00250  Alanine, aspartate and glutamate metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SerAS9_1194
Enzymes [BR:srr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SerAS9_1194
Peptidases [BR:srr01002]
 Cysteine Peptidases
  Family C44
   SerAS9_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: AEF44334
Position
complement(1304382..1306046)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDLKSDPVELRKKALELSRLMRHRGPDWSGVYASDKAILVHERLSIVDVNNGA
QPLYNAAHTHVLAVNGEIYNHQSLRQELGERYEFQTASDCEVILALYQEKGIDFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGHDEFGNLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYQRDWFDYDNVKDNVTDANALRNALEDSVKSHLMSDVPYGVLLSGGLDS
SVISAITKKYAARRVEDQERSEAWWPQLHSFAVGLEGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVFGGYLY
FHKAPDAREFHDETVRKLLALHMFDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPKD
KMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ARFRFPYNTPSSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKKMDD
PSGRAVGVHQAAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggtgtgctcgatctgaagtccgatcccgttgaactgcgtaagaaa
gcgctggagctgtctcgtctgatgcgccaccgcggcccggactggtccggcgtttacgcc
agcgataaagccattctggtgcatgagcgcctgtcgattgtcgacgtcaacaatggcgcc
caaccgctgtacaacgctgcgcacacccacgttttggccgtaaacggtgagatctataac
caccagtcactgcgtcaagaactgggcgagcgctacgagttccagaccgcttccgactgt
gaagtgatcctggcgctgtatcaggaaaaaggcatcgatttcctcgacgatttgcagggc
atgtttgccttcgccctttatgattcagagaaggacgcttacctgattggccgcgatcac
ttgggcattatcccgctctacatgggtcatgacgaattcggcaacctgtatgtcgcctcc
gaaatgaaagcgctggtgccggtctgccgcaccatcaaagaattcccggcgggcagctat
ctgtggagccaggacggtgagatccgcgaatattaccagcgcgactggttcgactacgac
aatgtcaaagacaacgtgaccgatgccaacgcattgcgcaacgcgctggaagattcggtg
aaaagccacctgatgtccgacgtgccgtacggcgtactgctgtctggcggcctggattct
tccgtgatctccgccattaccaaaaaatacgccgcacgtcgtgtggaagatcaagagcgc
agcgaagcctggtggccacaactgcactccttcgccgtcggcctagaaggttcaccggat
ctgcgcgccgcgcaggaagtggccaaccatttaggcaccgtgcaccatgaaattcatttc
accgtgcaggaaggcctggatgccatccgcgacgtgatttatcacatcgaaacctacgac
gtcaccaccattcgcgcctccacgccaatgtacttgatgtcgcgtaaaatcaaagcgatg
ggcatcaagatggtgctgtccggcgaaggtgcggacgaagtattcggcggttatctgtac
ttccataaggcgccggatgcgcgtgagttccacgacgagaccgtgcgtaagctgctggcg
ctgcatatgtttgactgcgcacgcgccaacaaggcgatgtccgcctggggcgtggaagcc
cgcgtacccttcctggataaaaaattcctcgacgtggcgatgcgcatcaacccgaaagat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgcgagtgttttgaatcctat
ctgccggccagcgtagcctggcgccagaaagaacagttctccgacggcgtgggctacagc
tggatcgacacgctgaaagaagtcgcagcgaagcaaatcagcgatcaacagctcgaaacc
gcacgtttccgtttcccgtacaacacgccgagctcaaaagaaggctacctgtatcgcgaa
atcttcgaagagctgttcccactgccaagcgcggccgaatgcgtacctggcggcccgtca
gtggcttgctcttcagcgaaagccatcgaatgggatgaatccttcaaaaagatggacgat
ccttctggtcgtgcagtcggcgttcaccaggccgcctataaataa

DBGET integrated database retrieval system