KEGG   Serratia plymuthica AS9: SerAS9_1495Help
Entry
SerAS9_1495       CDS       T01503                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00020  Citrate cycle (TCA cycle)
srr00620  Pyruvate metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01200  Carbon metabolism
Module
srr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS9_1495
   00620 Pyruvate metabolism
    SerAS9_1495
Enzymes [BR:srr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SerAS9_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEF44631
Position
complement(1608768..1610345)
Genome map
AA seq 525 aa AA seqDB search
MRKLLVLIFCLNLFGITQQAAAEENKTVDVVLIGGGIMSATLGTYLHELEPNWSIDMYER
MNGVAEESSNGWNNAGTGHSAFAEMNYTPEKEDGTIDISKAVVVNESFEISRQFWSYQVK
NNVLKDPKSFINSVPHMSFVWGDDNVNFLRKRYEALQHSTLFRGMEYSEDANQIKQWAPL
VMNGRDPAQKIAATRMPLGTDVNFGVITHQLVDTLTKNPNFKLNLSHEVRDIKRNADNTW
RVTVADLNRDGKETTVNAKFVFIGAGGASLTLLQKSGIPEADGYGGFPVGGQFLVTTNPE
VANQHLAKVYGLASVGSPPMSVPHLDTRMLDGKRVVLFGPFATFSSKFLKNGSLFDLLHS
LSTSNLMPMTHVGLDNFDLVKYLVGQLMMNDDDRFAALKEYFPEAKQADWKLWTAGQRVQ
IIKKDDEKGGVLQFGTEVVSSEDGSIAALLGASPGASTAAPIMLHLMEKVFKDKVATPEW
QSKLKDIIPSYGHKLNGDIEMTNKIRGYTSSVLQLDYIEVKPETH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattactcgtcctgatcttctgtctgaatctgttcggcatcacgcaacaggct
gcagcagaagagaacaagaccgtcgatgtggtactgattggcggcggcatcatgagcgcc
accctggggacttacctgcatgaactggagccgaattggtccatcgacatgtatgagcgc
atgaacggcgttgcggaagaaagttccaacggctggaataatgccggtaccggccactcc
gctttcgccgaaatgaactacacgccagagaaagaagacggcaccattgatatcagcaaa
gccgtggtggttaacgagtcttttgaaatctctcgtcagttctggtcttatcaggtaaaa
aataacgtcctgaaagatccaaaatcctttattaacagcgtaccgcacatgagctttgtc
tggggtgacgataacgtcaacttcctgcgcaaacgctatgaggcgctgcagcacagcacc
ctgttccgtgggatggaatactccgaagacgccaaccagattaaacagtgggcgccgctg
gtaatgaacggccgcgatccggcgcagaaaattgccgcgacccgcatgccgctgggtacc
gacgtcaactttggcgtgatcacccatcaactggtggatacgctgaccaaaaatcctaac
ttcaagctgaacctgagccatgaagtgcgcgatatcaaacgcaacgccgacaacacctgg
cgcgtcaccgtggccgatctgaaccgtgacggtaaagaaaccaccgttaacgccaaattc
gtgtttatcggggcaggcggtgcctctctgacactgttgcagaaatccggcattcctgaa
gctgacggctacggcggtttcccggtcggcggccagttcctggtgaccaccaatccggaa
gtggcgaatcagcatctggccaaggtttacggtctggccagcgtaggttcgccgccaatg
tcggttccgcacctggacacccgcatgctggatggcaagcgcgtcgttctgttcgggcca
ttcgccaccttctccagcaagttcctgaaaaacggttcgctgttcgatctgctgcactct
ctgagcacgtctaacctgatgccgatgacccatgtcgggctggataacttcgacctggtg
aaatacctggttggccagttgatgatgaacgacgatgaccgtttcgctgcgctgaaagag
tacttccctgaagccaaacaggccgactggaagttgtggaccgccggccaacgcgtgcag
atcatcaagaaagatgatgagaaaggcggcgtgttgcagttcggcaccgaagtggtcagc
tccgaggacggcagcatcgccgccctgctcggcgcatcaccgggcgcctctaccgctgcg
ccaatcatgctgcacctgatggaaaaagtgttcaaagataaagtggcgacgccggaatgg
cagagcaagctgaaagatatcattccatcctatggtcacaagctgaacggcgacattgaa
atgaccaacaagatccgcggctacaccagcagcgtcttgcagttggactatatcgaagtg
aagccggaaactcactga

DBGET integrated database retrieval system