KEGG   Serratia plymuthica AS9: SerAS9_1643Help
Entry
SerAS9_1643       CDS       T01503                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00260  Glycine, serine and threonine metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
srr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SerAS9_1643
Enzymes [BR:srr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SerAS9_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEF44774
Position
complement(1770680..1771696)
Genome map
AA seq 338 aa AA seqDB search
MLIDLRSDTVTRPCAAMRQAMAQAEVGDDVYGDDPTVNALEAEAVRLSGKEAALFLPSGT
QANLVALLSHCQRGDEYIVGQQAHNYKYEAGGAAVLGSIQPQPIEANPDGTLPLDKVAAA
IKPDDIHFARTRLLSLENTISGRVLPQEYLQQAWQFTREHQLALHIDGARIFNAAVALNL
PLKEIVQYCDTFTICLSKGLGAPVGSLLCGSEAFIQRAVRWRKMTGGGLRQAGILAAAGL
YALEHNVERLRDDHDNAKWLEQQLQGMGVEIAEPGAQTNVLYLRQSPELAAKLGPWMRER
GVLISSGPLTRILTHLDVSRQDLQQVVDLWWEFLRQHA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcgatttacgcagtgacaccgtgacccgcccctgcgccgccatgcgccaagcc
atggcgcaggccgaagtgggcgacgacgtttatggcgatgatcccacggtaaacgcgctg
gaggcggaagcggttcgtctgtccggcaaggaagcggcgctgtttctgccgagcggcacc
caggccaacctggtggcgctgttgagccattgtcagcgcggcgatgagtatattgtcggc
cagcaggcgcataactataaatacgaggccggcggcgcggcggtgctcggcagcatccag
ccgcagccgattgaggcgaacccggacggcaccctgccgctggacaaagtagcggcggca
atcaaacccgatgacattcacttcgccagaacccgtctgctgagcctggaaaacaccatc
agcggccgcgtgctgccgcaggagtacctgcaacaggcctggcagttcacccgcgagcat
caattggcgctgcacatcgacggcgcgcgcatcttcaatgccgccgtcgcgctgaacctg
ccgctgaaagagattgtgcaatactgcgacaccttcaccatctgcctgtcgaaagggctg
ggcgcgccggtaggctcgctgctgtgcggcagtgaagcctttattcagcgcgccgtgcgc
tggcgcaaaatgaccggcggcggcctgcgccaggccggtattctggcggcagcgggtttg
tatgcgctggagcataacgtcgaacggctgcgcgatgaccacgacaacgccaaatggctg
gaacagcaattgcaggggatgggcgtggaaattgctgagccgggcgcacaaaccaacgtg
ctgtacctgcgccaatcgccagagctggcggcaaagctggggccgtggatgcgagagcgt
ggcgtgctgatcagcagcgggccgctgacgcgcattctgacccatctcgacgtcagccgt
caggatctgcagcaagtcgtcgatttatggtgggagttcctccggcagcatgcctga

DBGET integrated database retrieval system