KEGG   Serratia plymuthica AS9: SerAS9_2026Help
Entry
SerAS9_2026       CDS       T01503                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00052  Galactose metabolism
srr00500  Starch and sucrose metabolism
srr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SerAS9_2026
   00500 Starch and sucrose metabolism
    SerAS9_2026
Enzymes [BR:srr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SerAS9_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AEF45152
Position
complement(2177004..2178446)
Genome map
AA seq 480 aa AA seqDB search
MNNALAQADHAVETLRAQRQDDYYPQFHLAPAAGWINDPNGLVYINGVYHAFYQHHPYDE
NWGPMHWGHAISRDLAHWQHQPIALAPGDDYDKDGCFSGCAVDDNGVLTLIYTGHVWLDK
VGDDDQVREVQCLATSEDGVHFVKHGPVLAPPEGIQHFRDPKVWRESDGWWMVVGAKQNG
LGQARLYRSKDLRDWQFDRVLDGAQTLHQGYMWECPDFFPLGEKQVLLFSPQGLAAQGYR
HRNRFQSGYLLGHWQPGADFNVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHGWAGALTLPRELTLNAEGDVLMNPARELAALRGIPQTFAAAQLRNQRQLLAENV
QELTLSLDLAASDAERYGIAIGNAARLYVDNQAHRLVLERFSEEPGLCGCRSVPLPAGDT
LSLSVFIDRSSLEVFVNQGVACLTSRIYPTDGLRSVSLFAESGQAQFGALQGWELKSIWA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgccttagctcaagccgaccatgcggtcgaaaccctgcgcgcacagcgtcag
gacgattactacccgcaatttcatctggcgcctgccgccggctggatcaacgatcccaat
gggctggtgtacattaacggcgtttatcatgcgttctatcaacaccacccctacgacgaa
aactggggaccgatgcactggggccacgccatcagccgggatctggcgcactggcagcac
cagccgatagccctggcgcccggcgacgactacgacaaagacggctgtttctccggctgc
gcagtggacgataacggcgtgctgacgctgatctacaccggccacgtctggctggacaaa
gtgggcgatgacgatcaggtacgtgaggtacagtgcctggccaccagcgaggacggcgta
catttcgtcaagcacgggccggtgttggcgccgccggaaggcattcagcatttccgcgat
cccaaggtctggcgcgagagtgacggctggtggatggtggtcggcgccaaacaaaacggc
ctcgggcaggcacggctttatcgttcaaaagatctgcgtgactggcagtttgaccgcgtg
ctggacggcgcgcagacgctgcatcagggctatatgtgggagtgcccggatttcttccct
ctcggcgaaaaacaggtgctgctgttctcgccgcaggggctggcggcgcagggctaccgc
caccgtaaccgcttccagagcggctatttgctcggtcactggcagccgggcgctgatttc
aacgtcactcaacctttctgcgaactggacgccgggcatgatttctatgcgccgcaaacc
tttaccgccgccgacggtcgccgcctgctgttcgcctggatggacatgtgggaatcgccg
atgccgagcaaggcgcacggttgggccggcgcgcttaccctgccccgcgaactgacgctg
aatgccgaaggcgatgtgctgatgaacccggcgcgggagttggcggcgctgcgcggcata
ccgcagacgtttgccgcagcgcaactgcgcaaccaacgccagcttctggcggagaacgtg
caagagctgacgctgtcgctggatctggccgccagcgatgccgaacgctacggtatcgcc
attggcaacgccgcgcggctgtacgtggacaaccaggcccacaggctggtgttggagcgt
ttcagcgaggaaccgggtctgtgcggttgccgcagcgtgccgctgccggcgggcgacacg
ctgtcgctgagcgtgtttatagaccgttcatcgctggaagtgttcgtcaatcagggcgtt
gcctgcctgaccagccgcatctacccgaccgatggcctgcgcagcgtgagcctgtttgcc
gaaagcggccaggcgcagtttggcgcgctacaggggtgggaactgaaaagcatctgggcc
tga

DBGET integrated database retrieval system