KEGG   Serratia plymuthica AS9: SerAS9_2418Help
Entry
SerAS9_2418       CDS       T01503                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00010  Glycolysis / Gluconeogenesis
srr00020  Citrate cycle (TCA cycle)
srr00620  Pyruvate metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
srr01200  Carbon metabolism
Module
srr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_2418
   00020 Citrate cycle (TCA cycle)
    SerAS9_2418
   00620 Pyruvate metabolism
    SerAS9_2418
Enzymes [BR:srr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SerAS9_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AEF45543
Position
complement(2602373..2603629)
Genome map
AA seq 418 aa AA seqDB search
MPEIRHAVVPDIGDDQPIPLVEILVAVGDYIALNQGLITLESDKATLEIPATFSGRVTEL
LVKPNDRLSAGSPIAAIEVEEETPSEPLPVNVAVPAPSPVPAMPVAVREPTAPARPGTAA
YASPLVYRLARELGVDLQRLTGSARQGRITRNDVMQHVRSALSAQPQATSTLAAALLPWP
EVDFSRFGETERRPLTRIQTMSAANLSRNWALIPHVTHHDHADITELEALRATLNRENGP
EGVKITLLAFLLKASSVALRAFPQFNASLDIDGKQLIMKKYLHIGFAVETPQGLVVPVVR
NVDEKSVTQLAQEIAALSKKAREGVLTASEMSGGCFTLSSLGGIGGLAFTPIINAPEVAI
LGISTACWQPVWDDREFIPRLLLPLSLSYDHRVIDGALAARFSVYLTGLLADIRRLLL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaataagacatgccgtggtgccggacatcggcgacgaccagccaattccgctg
gtcgagatactggttgccgtgggggattacattgcgctgaaccaggggttgattaccctg
gaatccgacaaggcgacgctggagatccccgccaccttcagtggccgcgtcaccgagctg
ctggtcaaaccgaatgacaggctgtcggccggtagcccgatcgccgccattgaggtcgaa
gaagagacgccaagcgaaccgctgccggtgaacgttgccgtaccagcgccctcacccgtg
ccggccatgcccgttgccgtcagagaaccgacagcgccggcccgcccgggtactgcagct
tatgccagtccgctggtgtaccgtttggctcgcgagcttggggtggacctgcagcggtta
accggcagcgcccgacaggggcgcattacccgcaatgacgttatgcaacatgtcagatcc
gctctgagcgctcaacctcaggcaacgtcaacactcgcagcggcgttgctgccgtggcct
gaggtcgatttcagccggttcggcgaaaccgaacgccggccgctaacgaggatccaaacg
atgtcggccgctaacctgagccgaaactgggcgttgatcccgcatgtaacgcaccatgat
catgccgatattaccgagttggaagcgctgcgggcaacgctgaaccgtgaaaacggcccg
gaaggcgtgaaaattaccctgctggcatttctgctcaaagccagctccgtcgcgttaagg
gcgtttcctcagttcaatgcttcgctggatatcgacggcaaacagctgattatgaagaag
tacctgcacattggttttgccgtggaaacaccacagggattggtggtgccggtagtgcgc
aacgtcgatgaaaaaagcgtgacgcagttggcgcaggagatcgccgcattgagcaaaaag
gcgcgtgaaggcgtattgacagcctcagagatgagcggtggctgcttcacgttgtcctcg
ctggggggcattggcgggctggcgtttaccccgatcatcaatgcgccggaggtcgcgata
ctggggatctcgaccgcgtgttggcaaccggtgtgggacgatagggagtttattccccgc
ctgctgttgccgttgtcgctgagctacgaccaccgggtgattgacggtgccctcgccgct
cgttttagcgtttatctgaccggtctgttggccgatatccgccgtctgttactctga

DBGET integrated database retrieval system