KEGG   Serratia plymuthica AS9: SerAS9_2734Help
Entry
SerAS9_2734       CDS       T01503                                 

Definition
(GenBank) Acetaldehyde dehydrogenase (acetylating)
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00010  Glycolysis / Gluconeogenesis
srr00071  Fatty acid degradation
srr00350  Tyrosine metabolism
srr00620  Pyruvate metabolism
srr00625  Chloroalkane and chloroalkene degradation
srr00626  Naphthalene degradation
srr00650  Butanoate metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
srr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_2734
   00620 Pyruvate metabolism
    SerAS9_2734
   00650 Butanoate metabolism
    SerAS9_2734
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SerAS9_2734
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SerAS9_2734
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SerAS9_2734
   00626 Naphthalene degradation
    SerAS9_2734
Enzymes [BR:srr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SerAS9_2734
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SerAS9_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 Peripla_BP_6 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AEF45855
Position
2932569..2935241
Genome map
AA seq 890 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIVGWIDQPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DSGVICASEQSVIVVDSIYDAVRERFSSHGGYLLQGKELKAVQDIILKNGGLNAAIVGQS
APKIAEMAGIKVPSSTKVLIGEVKLVDESEPFAHEKLSPTLAMYRAKDFEDAVSKAEKLV
AMGGIGHTSCLYTDQDNQPERVAFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQITTVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVLYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEYLPASYKEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLVWLDEIKTELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGRKFSEADDEEVLVAPVAAKAEKKSKK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaactgaacgagctagtcgcacgtgtcaaaaaagcccag
cgcgaatatgccaacttcactcaagagcaagttgataaaatcttccgcgctgctgccctc
gccgctgccgatgcccgtattcccttggccaaaatggccgttgaagaatccggtatgggt
atcgttgaagataaagtgatcaaaaaccacttcgcttcagagtatatctacaacgcgtat
aaagatgaaaaaacctgcggtatcctgtctgaagacgatacctttggcacgatcaccatc
gccgagcctattggcttgatttgcggtatcgtaccgaccaccaacccaacctctacggct
atttttaaagcgctgatcagcctgaaaacccgtaacggcattatcttctcaccacatccg
cgtgcgaaaaacgccaccaacaaagcggcggatatcgtgttgcaggcggcaatcgctgcc
ggggcaccaaaagacatcgtcggctggattgaccagcctaccgttgagctgtccaaccag
ctaatgcaccacccggacatcaacctgatcctcgctaccggcggtccaggtatggtgaaa
gccgcctacagctccggcaagcctgcaatcggtgttggcgccggtaacaccccagtggtg
gttgacgagacagcggacatcaaacgcgttgtggcctctattttgatgtctaaaaccttc
gacagcggtgtgatttgcgcctccgagcagtctgtcatcgtcgttgactccatctatgat
gcagtgcgtgagcgcttctcttcccacggcggctacctgctgcagggcaaagagctgaag
gcggtccaggacatcattctgaaaaacggcggcctgaatgcggccatcgtcggccaatcc
gcgcctaaaatcgctgaaatggccggtatcaaagtgccttccagcaccaaggtactgatc
ggtgaagtgaaattggtcgatgaatccgaacctttcgctcacgaaaagctgtctccgacg
ctggcaatgtatcgcgccaaagattttgaagacgccgtcagcaaagctgaaaaactggtc
gccatgggcggtatcggccatacgtcctgcctgtacaccgaccaggataaccagccggaa
cgcgttgccttcttcggcgacaagatgaaaaccgcacgtatcctgatcaacaccccggcg
tctcagggtggtatcggtgacctgtacaactttaaactcgctccgtcactgacgctgggc
tgcggttcctggggtggtaactccatctctgaaaacgtcggtccaaaacacttgatcaac
aagaaaactgtagcgaagcgagcagaaaacatgttgtggcataaacttccgaaatcaatc
tacttccgccgtggctcattgcctatcgcgctggaagaagtagcgaccgacggggcaaaa
cgcgccttcattgtgaccgaccgctacctgttcaacaacggctatgcagaccagatcacc
acggttctgaaatcgcacggcattgaaacagaagtgttcttcgaagtagaagctgaccca
acgctgtccatcgtgcgtaaaggcgccgagcagatgaactccttcaaaccagacgtgatc
atcgcgctgggcggcggttcaccgatggatgctgcgaagatcatgtgggtgttgtacgag
catccggaaacccatttcgaagacctggcgctgcgctttatggatatccgtaaacgcatc
tacaagttcccgaaaatgggcgtcaaagcaaaaatgattgccgtcaccaccacctcaggt
accggttctgaagtcacgccgtttgcggtagtgaccgacgatgcgaccggccagaaatac
ccgctggctgactacgcattgacgccggatatggcgatcgttgacgccaatctggtgatg
aacatgccgaaatccctctgtgccttcggcggcctggatgcggttacccatgcgctggaa
gcttatgtttcggtactggcgaacgaatactctgacggccaggcgctgcaagcgctgaaa
ttgctgaaagagtatctgcccgccagctacaaggaaggcgccaagaacccggtggcccgt
gagcgcgtgcacaacgccgcgaccattgccggtatcgcgtttgccaacgccttcctgggg
gtttgccactccatggcccacaaactgggctctgagttccatatcccgcacggcctggcc
aacgccatgttgatctccaacgtcattcgctataacgcgaacgacaatccgaccaagcag
acggccttcagccagtacgaccgcccgcaggcacgtcgtcgctacgctgagatcgccgac
cacctcggtctgagcgcaccgggcgaccgtaccgcgcaaaaaatcgagaaactgctggta
tggctggatgagatcaaaaccgagctgggcatccctgcttccatccgtgaagccggcgtg
caggaggctgacttcctggcgaaggtcgacaaactgtccgaagacgcttttgacgaccag
tgtaccggcgccaacccgcgttatccgctgattgccgagctgaagcaaatcatgctggat
accttctacggccgtaagttcagcgaagcggatgatgaagaagttttggttgcaccggtt
gcggccaaagcggaaaaaaagtccaaaaaataa

DBGET integrated database retrieval system