KEGG   Serratia plymuthica AS9: SerAS9_2740Help
Entry
SerAS9_2740       CDS       T01503                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00040  Pentose and glucuronate interconversions
srr00052  Galactose metabolism
srr00500  Starch and sucrose metabolism
srr00520  Amino sugar and nucleotide sugar metabolism
srr01100  Metabolic pathways
srr01130  Biosynthesis of antibiotics
Module
srr_M00362  Nucleotide sugar biosynthesis, prokaryotes
srr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SerAS9_2740
   00052 Galactose metabolism
    SerAS9_2740
   00500 Starch and sucrose metabolism
    SerAS9_2740
   00520 Amino sugar and nucleotide sugar metabolism
    SerAS9_2740
Enzymes [BR:srr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SerAS9_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: AEF45861
Position
complement(2939670..2940587)
Genome map
AA seq 305 aa AA seqDB search
MPAVNRKIRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPKGVTVMQVRQGVAKGLGHAIM
CAYPLVGDEPVAVILPDVILDEYSADLKKDNLHEMLQRFEQTGISQIMVEPVPQKDVGNY
GVADCKGYELQAGESAPMVSVVEKPSPDKAPSNLAIVGRYVLSADIWPLLAKTPPGAGGE
IQLTDSIEMLMQQETVEAYHLKGVSHDCGNKLGYMQAFVEYGLRHASLGKEFSQWLQQLL
VTDKK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtaaatcgtaaaatcagaaaggcagtgatcccggttgcaggcttgggaaca
cgaatgttgccggcgacaaaagccatcccaaaagaaatgttgccgctggttgacaagcca
ttgatccagtacgtggtcaatgaatgcattgcggcagggattaacgagattgtgctggtc
acccattcctccaagaattcgattgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgcgttaagcgccaattattggatgaagttcagtctatttgcccgaaa
ggcgtcaccgtgatgcaagtgcgtcaaggggtggcgaaaggccttgggcatgccattatg
tgcgcttatccattggtgggcgatgagccggttgccgtaattttgccggacgtgatcctc
gatgagtacagcgccgatctgaaaaaagacaatttgcacgaaatgctgcagcggttcgaa
caaaccggcatcagccagattatggtcgaacctgtgccacagaaagatgtcggcaattat
ggcgtggctgattgcaaaggttatgaactgcaggcgggtgaaagcgctccgatggtcagt
gtggtcgaaaaaccttcgccagacaaagcgccgtcaaacctggctattgttggccgctat
gtgctttctgccgatatttggccgctgctggcgaaaacgcctccaggcgccggcggtgag
atccaacttaccgacagtattgaaatgctgatgcagcaggaaaccgtagaagcctatcac
ctcaaaggggtgagccatgactgcggcaacaagctgggctacatgcaggctttcgtcgag
tatggcctgcgccatgccagccttggcaaagaattttctcagtggttgcaacaactgttg
gtcactgataagaaataa

DBGET integrated database retrieval system