KEGG   Serratia plymuthica AS9: SerAS9_4637Help
Entry
SerAS9_4637       CDS       T01503                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
srr  Serratia plymuthica AS9
Pathway
srr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:srr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SerAS9_4637
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:srr03011]
    SerAS9_4637
Ribosome [BR:srr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SerAS9_4637
  Bacteria
    SerAS9_4637
  Archaea
    SerAS9_4637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: AEF47731
Position
complement(5010508..5010840)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTDKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgccttgtt
gcagacctgatccgcggtaagaaagtgtcgcaagctctggaaactctgacctacaccgac
aagaaagctgccggtctggttaagaaagtgctggagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaaaatcttcgtagacgaaggccca
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system