KEGG   Serratia plymuthica AS9: SerAS9_4901Help
Entry
SerAS9_4901       CDS       T01503                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00010  Glycolysis / Gluconeogenesis
srr00051  Fructose and mannose metabolism
srr00562  Inositol phosphate metabolism
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
srr01120  Microbial metabolism in diverse environments
srr01130  Biosynthesis of antibiotics
srr01200  Carbon metabolism
srr01230  Biosynthesis of amino acids
Module
srr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
srr_M00002  Glycolysis, core module involving three-carbon compounds
srr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SerAS9_4901
   00051 Fructose and mannose metabolism
    SerAS9_4901
   00562 Inositol phosphate metabolism
    SerAS9_4901
Enzymes [BR:srr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SerAS9_4901
Exosome [BR:srr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SerAS9_4901
  Exosomal proteins of bladder cancer cells
   SerAS9_4901
  Exosomal proteins of melanoma cells
   SerAS9_4901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEF47994
Position
5307018..5307785
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRNELSSVDGCGVAIAPPVMYLDQAKHALAGSRIA
LGAQNVDVNLSGAFTGEVSADMLKDVGAQYIIIGHSERRTYHKETDAAIAEKFAVLKAAG
LIPVLCIGETDAENEAGKTEEVCARQIDAVLKTQGAEAFKGTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAEVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaagcttaacggcagcactcacatggttaac
gaactcattgccgctctgcgcaatgaactgagcagcgttgacggttgtggcgtggctatc
gcaccgccggtgatgtacctggatcaggccaagcacgctctggccggcagccgcattgct
ctgggcgctcaaaatgtagacgtgaacctgtccggtgcattcaccggcgaagtttccgct
gacatgctgaaagatgtaggcgcgcaatacatcatcatcggccactccgaacgtcgcact
taccacaaagaaaccgacgctgcgatcgccgaaaaatttgccgtgctgaaagcggctggt
ctgatcccggtgctgtgcatcggtgaaaccgatgcagaaaacgaagcgggtaaaaccgaa
gaagtttgcgcacgccagatcgacgccgtgctgaaaacccagggcgcggaagcgttcaaa
ggtaccgttatcgcttatgagccagtttgggccatcggtaccggcaaatcagctactcct
gcgcaggcacaggcagtacacaaatttatccgcgatcacatcgccaagcaggacgcagcc
gtagctgcagaagtgattatccagtacggcggctctgtgaacgataagaatgctgccgag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcatcactgaaagctgac
gctttcgccgtgatcgtcaaagccgctgcagccgctaaaaaagcctga

DBGET integrated database retrieval system