KEGG   Serratia sp. AS12: SerAS12_0032Help
Entry
SerAS12_0032      CDS       T01502                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
srs  Serratia sp. AS12
Pathway
srs00051  Fructose and mannose metabolism
srs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SerAS12_0032
Enzymes [BR:srs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SerAS12_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEF48149
Position
37140..38291
Genome map
AA seq 383 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAHAELTFADVNQSVLDLLNSRKSYQVHVVGEQARVESV
NNVSAVNSGSEEAVALIAEADIVTTAVGPQILAKIAGTVAKGLIKRHQQGNTRPLNIIAC
ENMVRGTSQLKQHVFDALPQDEQAWVEQHIGFVDSAVDRIVPPAEAGSDDPLEVTVETFS
EWIVDQTQFKGQPPAIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQQAALLTIRDAIL
DSAIRRVVKGAMEESGAVLIKRYGFDADKHAAYIDKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHDNLIQGIAAAMSYRSEQDPQAQELVELLTKLGPKAALAQ
ISGLPVESEVVEQAVAVYNAMQK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacatttcggtgcagggaatatcgggcgtggttttatcggcaagctgctg
gcggacgcgcacgccgaactgacctttgccgacgttaaccaaagcgtgctggacctgctg
aacagccgcaaaagctatcaggttcacgtcgtgggtgagcaggcgcgggttgagagcgtg
aataatgtcagcgcggttaacagcggcagcgaagaggcggtggcgctgatcgccgaagcg
gacatcgtgaccaccgccgtcggtccgcagatcctggctaaaattgccggcactgtcgcc
aaaggactgatcaaacgccatcagcagggtaacactcggccgctgaacatcatcgcctgc
gaaaacatggtgcgcggcaccagccagttaaaacagcacgtgttcgacgcgttgccgcaa
gatgagcaggcgtgggtcgaacagcatatcggttttgtcgattcggcagtggaccgcatc
gtgccgccggcggaagcgggcagcgacgatccgctggaagtgacggtagaaaccttcagc
gagtggattgtcgatcagacccagttcaagggccaaccaccggcgatcgccggcatggaa
ctgaccgataacctgatggcgtttgtcgaacgcaagctgtttacgctcaataccggccac
gccatcaccgcttaccttggccaacaggccgctctgctgaccatccgtgatgcgatcctc
gactcggctatccgccgcgtggtgaaaggcgcgatggaagagagcggtgcggtgctgatc
aagcgctacggctttgacgccgacaagcacgcagcctacatcgacaaaatcctcagccgc
tttgaaaacccgtatctgcacgatgatgtcgagcgcgtgggccgccagccgctgcgtaaa
ctgagcgccggtgaccgcctgatcaaaccgctgctgggcacgctggaatatggcctgccg
cacgacaacctgatccagggtatcgccgccgcaatgagctaccgcagtgagcaggatccg
caggcgcaagagctggtggagttgttgaccaaactggggccaaaagcggctctggcgcaa
atttccggcctgccggttgaaagtgaggttgtagaacaggcggttgctgtgtataacgcc
atgcaaaagtag

DBGET integrated database retrieval system