KEGG   Serratia sp. AS12: SerAS12_0291Help
Entry
SerAS12_0291      CDS       T01502                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4704 family
Organism
srs  Serratia sp. AS12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: AEF48405
Position
337581..338492
Genome map
AA seq 303 aa AA seqDB search
MMKARVLALSLSVLPLAAMFTVPVAQSEELMKWERIPLQIPLAVGKERVLFADKNVRVGF
PPALNGKLRVQSSGGAVYLKADAAFPPTRLQLQDVENGGVILLDVTASDKGSAEPVRIVY
SGDVSSISSSNDTATSSAGSPSAAPGAEDGTQAKRKKIRYNAPLPVVLTRYAAQSLYGPV
RTVEAVPGIHPVNPHLPKRITTLYPSEPVAITLLGGWGIGSRNVVALKVQNTASRKIILD
PRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGAFVAEPSGVRKAVKAAKKGA
NHG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcacgcgttcttgcgctttccctgagtgtgcttcccctggcggcgatgttc
accgtaccggtagcccagtcggaagagctgatgaaatgggagcgtatcccgctgcaaatc
ccgctggccgtcggcaaggagcgggtgctgtttgccgataaaaatgttcgcgtcggtttc
ccgccggcactgaacggcaagctgcgggtgcaaagcagtggcggggctgtttatctgaaa
gccgatgccgcatttccgccaacgcgtctgcaactgcaggacgtcgaaaacgggggggtt
attctcctcgatgtgacggcatcggacaaaggctccgccgagccggtgcgtattgtctac
agcggtgatgtgtcgtcgatcagtagcagtaatgataccgcgacctcgtcagccgggagc
ccttcggcagcgcctggggcggaagacggcacccaggcgaagcgtaaaaaaatcagatac
aacgccccgctgccggtggtgctgacacgctatgcggcacaaagcctgtacggtccggtg
cgcacggttgaggcggtgcccggcattcacccggtcaacccgcacctgccgaaacgtatc
accacactgtacccgtcagagccggtggccatcaccctgctgggcggctggggtattggc
agtcgtaacgttgtggcgctaaaagtgcagaacaccgccagtcgcaaaatcatcctggat
ccgcgggtactgcaggggcagttcgtgacggccaccttccagcaccgttatctggggccg
gtgggtaccccggaggacactaccacgctgtacctggtcaccgccggtcgcccggatggg
gcgtttgtcgcggagccgtcgggggttcgcaaagcggtgaaggcagcgaagaagggggca
aaccatggctga

DBGET integrated database retrieval system