KEGG   Serratia sp. AS12: SerAS12_1417Help
Entry
SerAS12_1417      CDS       T01502                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
srs  Serratia sp. AS12
Pathway
srs00480  Glutathione metabolism
srs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SerAS12_1417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:srs02000]
    SerAS12_1417
Enzymes [BR:srs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SerAS12_1417
Transporters [BR:srs02000]
 Other transporters
  Pores ion channels [TC:1]
   SerAS12_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AEF49505
Position
1533297..1533920
Genome map
AA seq 207 aa AA seqDB search
MLKLLGKASSINVRKVLWTCHELEVALQREDWGSGFRSTQEPAFLALNPNGLVPVLIDGE
RVLWESNTICRYLVGREGRQDLLPLEPGARAGVEMWMDWQATDLNNAWRYVFMSRVRQDA
AYQDQARLADAEREWNRLMGILEQHLAQGQAYMAGAAFSLADVVIGLSLNRWLMTPFSRP
DYPRLNAYLQRLKQRSGFLLYGANGLP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttattgggtaaagcatcatcgattaacgtgcgcaaggtactgtggacctgc
catgaacttgaggtggcattacagcgggaggattggggcagcggttttcgctccacccag
gaaccggcgtttttggcgcttaaccccaacgggctggtgccggtactgatcgacggcgag
cgggtgctgtgggaatccaatacgatttgccgctacctggtgggccgtgaagggcgccag
gatctgctgccgttggagccgggcgcgcgggccggggtcgagatgtggatggactggcag
gctaccgacctgaacaacgcctggcgctatgttttcatgtcgcgggtgcgtcaggatgcc
gcttatcaggatcaggcccggttggcggatgccgaaagggagtggaaccggctgatgggc
atactggaacagcacctggcgcagggccaggcttatatggccggtgcggcttttagcctg
gcggacgtggtgatcgggctgtcgttgaaccgctggttgatgacgccgttctcgcgcccg
gattacccgaggctgaatgcgtatctgcaacggcttaagcagcggtcggggttcttgctg
tatggtgccaacggtttgccgtga

DBGET integrated database retrieval system