KEGG   Serratia sp. AS12: SerAS12_1495Help
Entry
SerAS12_1495      CDS       T01502                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
srs  Serratia sp. AS12
Pathway
srs00020  Citrate cycle (TCA cycle)
srs00620  Pyruvate metabolism
srs01100  Metabolic pathways
srs01110  Biosynthesis of secondary metabolites
srs01120  Microbial metabolism in diverse environments
srs01200  Carbon metabolism
Module
srs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
srs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SerAS12_1495
   00620 Pyruvate metabolism
    SerAS12_1495
Enzymes [BR:srs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SerAS12_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEF49583
Position
complement(1608756..1610333)
Genome map
AA seq 525 aa AA seqDB search
MRKLLVLIFCLNLFGITQQAAAEENKTVDVVLIGGGIMSATLGTYLHELEPNWSIDMYER
MNGVAEESSNGWNNAGTGHSAFAEMNYTPEKEDGTIDISKAVVVNESFEISRQFWSYQVK
NNVLKDPKSFINSVPHMSFVWGDDNVNFLRKRYEALQHSTLFRGMEYSEDANQIKQWAPL
VMNGRDPAQKIAATRMPLGTDVNFGVITHQLVDTLTKNPNFKLNLSHEVRDIKRNADNTW
RVTVADLNRDGKETTVNAKFVFIGAGGASLTLLQKSGIPEADGYGGFPVGGQFLVTTNPE
VANQHLAKVYGLASVGSPPMSVPHLDTRMLDGKRVVLFGPFATFSSKFLKNGSLFDLLHS
LSTSNLMPMTHVGLDNFDLVKYLVGQLMMNDDDRFAALKEYFPEAKQADWKLWTAGQRVQ
IIKKDDEKGGVLQFGTEVVSSEDGSIAALLGASPGASTAAPIMLHLMEKVFKDKVATPEW
QSKLKDIIPSYGHKLNGDIEMTNKIRGYTSSVLQLDYIEVKPETH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattactcgtcctgatcttctgtctgaatctgttcggcatcacgcaacaggct
gcagcagaagagaacaagaccgtcgatgtggtactgattggcggcggcatcatgagcgcc
accctggggacttacctgcatgaactggagccgaattggtccatcgacatgtatgagcgc
atgaacggcgttgcggaagaaagttccaacggctggaataatgccggtaccggccactcc
gctttcgccgaaatgaactacacgccagagaaagaagacggcaccattgatatcagcaaa
gccgtggtggttaacgagtcttttgaaatctctcgtcagttctggtcttatcaggtaaaa
aataacgtcctgaaagatccaaaatcctttattaacagcgtaccgcacatgagctttgtc
tggggtgacgataacgtcaacttcctgcgcaaacgctatgaggcgctgcagcacagcacc
ctgttccgtgggatggaatactccgaagacgccaaccagattaaacagtgggcgccgctg
gtaatgaacggccgcgatccggcgcagaaaattgccgcgacccgcatgccgctgggtacc
gacgtcaactttggcgtgatcacccatcaactggtggatacgctgaccaaaaatcctaac
ttcaagctgaacctgagccatgaagtgcgcgatatcaaacgcaacgccgacaacacctgg
cgcgtcaccgtggccgatctgaaccgtgacggtaaagaaaccaccgttaacgccaaattc
gtgtttatcggggcaggcggtgcctctctgacactgttgcagaaatccggcattcctgaa
gctgacggctacggcggtttcccggtcggcggccagttcctggtgaccaccaatccggaa
gtggcgaatcagcatctggccaaggtttacggtctggccagcgtaggttcgccgccaatg
tcggttccgcacctggacacccgcatgctggatggcaagcgcgtcgttctgttcgggcca
ttcgccaccttctccagcaagttcctgaaaaacggttcgctgttcgatctgctgcactct
ctgagcacgtctaacctgatgccgatgacccatgtcgggctggataacttcgacctggtg
aaatacctggttggccagttgatgatgaacgacgatgaccgtttcgctgcgctgaaagag
tacttccctgaagccaaacaggccgactggaagttgtggaccgccggccaacgcgtgcag
atcatcaagaaagatgatgagaaaggcggcgtgttgcagttcggcaccgaagtggtcagc
tccgaggacggcagcatcgccgccctgctcggcgcatcaccgggcgcctctaccgctgcg
ccaatcatgctgcacctgatggaaaaagtgttcaaagataaagtggcgacgccggaatgg
cagagcaagctgaaagatatcattccatcctatggtcacaagctgaacggcgacattgaa
atgaccaacaagatccgcggctacaccagcagcgtcttgcagttggactatatcgaagtg
aagccggaaactcactga

DBGET integrated database retrieval system