KEGG   Serratia sp. AS12: SerAS12_1753Help
Entry
SerAS12_1753      CDS       T01502                                 

Definition
(GenBank) Isovaleryl-CoA dehydrogenase
  KO
K21782  L-prolyl-PCP dehydrogenase [EC:1.3.8.14]
Organism
srs  Serratia sp. AS12
Pathway
srs00333  Prodigiosin biosynthesis
srs01100  Metabolic pathways
srs01130  Biosynthesis of antibiotics
Module
srs_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SerAS12_1753
Enzymes [BR:srs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.14  L-prolyl-[peptidyl-carrier protein] dehydrogenase
     SerAS12_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AEF49835
Position
complement(1908407..1909567)
Genome map
AA seq 386 aa AA seqDB search
MDFKFSNNQVELYESAYRFAFNVLDPNAHSRLSQQTVNIDLWKQAAAYGFVRGPVSSTFG
GLEMGALDTALMIEALGRGSRDIGLSFSLCAHLCACVIPLYRFGSSELKAKYLEPLVTGS
LIAANAATEPDAGSDIYSMKSTAQPCDGGYILNGNKVFITNAPIADLFIAYAKTNPDHGF
MGVSAFLIEKGTPGLSVGEVRPKDCLSNCPWSEVTFQDLFIPQSQLIGKPGAGGAIFHDS
MIWEKGCLSALFIGAMERLLETTLAYAKQRRQFGKAIGQFQSVSNRIIDMKLRLEQCRLM
LYRACWRHDQGLEAEADIAMSKLLISEYAVQSGLDAIQTFGGAAMDQELGLVRHLLNMIP
SRTFSGTNDIQREIVARKLGLRGTAL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggattttaaattctcaaataatcaggtggaactgtatgagtcagcctatcgttttgcc
tttaatgttctggatccaaatgcacactccaggctatcgcaacagacagtaaacattgat
ttatggaaacaagcggccgcttatggttttgtgcgtggccctgtttcatccacctttggt
ggtttggaaatgggggctttagataccgcattgatgatagaggccctgggaagaggaagc
cgcgatataggcctttcattctcactctgcgcccacttatgtgcctgcgttattccgctc
tatcgctttggttccagtgaattaaaagccaaatatcttgaacctctggtcaccggcagc
ttaattgcggccaatgccgcaaccgaacccgatgccggttcggatatttatagtatgaaa
tcgacggcacagccctgcgacggtggctatatacttaacggtaataaagtttttatcacc
aacgcccctatcgccgacctctttatcgcttacgccaaaactaatcctgaccacggtttt
atgggcgtttcggcttttctgatcgaaaaaggcacgccgggattatccgtgggcgaagtc
cgcccaaaagattgtctttccaattgcccctggagtgaggtgacttttcaagatctcttt
atcccgcaatcccagttgatcggcaaaccgggggcgggaggcgcgatcttccatgactcg
atgatatgggagaaaggttgtctgtccgccctgtttatcggcgcgatggagcgcctgctc
gaaaccaccctggcctacgccaagcaacgtcggcaatttggcaaggcgataggccaattc
cagtcagtttccaatcgcattattgatatgaagttacgcttggaacagtgccggttaatg
ctctatcgcgcctgctggcgacacgatcaaggtcttgaggctgaagccgatatcgccatg
agcaagctgttaatctctgaatacgcggtccaatccggcctcgatgccatccaaaccttt
ggtggagccgccatggatcaagagcttggtctggttcgccatctgttgaatatgatcccc
agtcggaccttctccggcaccaatgatatccaaagagaaattgtggcccgtaagttgggt
ttacggggaacggcattatga

DBGET integrated database retrieval system