KEGG   Serratia sp. AS12: SerAS12_2665Help
Entry
SerAS12_2665      CDS       T01502                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
srs  Serratia sp. AS12
Pathway
srs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
srs01100  Metabolic pathways
srs01110  Biosynthesis of secondary metabolites
srs01130  Biosynthesis of antibiotics
srs01230  Biosynthesis of amino acids
Module
srs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:srs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SerAS12_2665
Enzymes [BR:srs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SerAS12_2665
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SerAS12_2665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI HHH_4
Motif
Other DBs
NCBI-ProteinID: AEF50736
Position
2867480..2868841
Genome map
AA seq 453 aa AA seqDB search
MQETVLNKIVRDKAQWVAARQQQQPLASFHNEIVPSERGFYHALQGARTAFILECKKASP
SKGLIRENFDPVEIASVYKDFASAISVLTDEKYFQGSFDFLPLVSKAVTQPVLCKDFIID
PYQIYLARFYQADAILLMLSVLDDDQYRQLAAVAHSLNMGVLTEVISEEELQRAIALEAR
VVGINNRDLRDLSIDLDRTRQLAPRVPHGVTVISESGINNYGQIRELSHFANGFLIGSAL
MSETDLRAAVRRVTLGDNKVCGLTRPQDAAAAYQAGAIYGGLIFVGRSPRYVDINRAREV
IAGAPLKYVGVFCDAQVETLVQTVERLGLKAVQLHGAEDQAYIDALRAKLPDSCQIWKAL
SVKDSLPARDLQHVDRYLLDNGAGGTGQRFDWSVLHGQNLGNVMLAGGLSADNCVDAAKL
GCAGLDFNSGVESQPGIKDPARLAAVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtgctcaacaagattgttcgtgataaagcgcaatgggtcgcagcacga
cagcaacaacaaccactggccagctttcacaatgaaatcgtcccaagcgaacgcggcttt
tatcatgcactgcaaggagccagaacggcatttattcttgaatgcaaaaaagcgtcccct
tccaaagggttgatccgtgaaaactttgatccggtcgaaatcgcttcggtctacaaggat
ttcgcttcggccatctcggtactgaccgatgaaaagtacttccagggcagtttcgatttc
ctgccgctggtcagcaaggcggtcacgcagccggtgctgtgcaaagattttattatcgac
ccgtaccaaatctacctggcgcggttctatcaggctgatgccatcctgctgatgttgtcg
gtgctggacgacgatcaatatcgccagttggcagccgtggcgcacagcctgaacatgggc
gtgctgaccgaagtgatcagcgaagaagaactgcagcgggcaatcgcgcttgaggcacgc
gtggtcggcattaacaaccgtgacctgcgcgaccttagcattgatctggaccgtacccgc
caacttgcgccacgcgtgccgcacggggtgacggtgatcagcgaatccggcatcaacaat
tacggccaaatccgcgaactgagccacttcgccaacgggttcctgatcggcagcgcattg
atgtcggaaactgacctgcgcgccgcagtgcgtcgggtgacgctgggcgacaataaagtc
tgcgggctgacccgcccacaagatgccgcagccgcctatcaggcaggcgcgatctacggt
gggctgatttttgtcgggcgttcaccgcgttatgtcgacatcaaccgcgcccgcgaagtg
attgccggtgcgccattgaaatatgtcggcgtgttctgcgatgcgcaggtggaaaccctg
gtgcaaaccgttgaacgcctcggtctgaaggcggtacagctacacggcgcggaagatcaa
gcctatatcgacgccctgcgcgcaaaactgcctgattcctgccagatctggaaagcgctg
agcgtgaaagacagcttgccggcacgtgatctgcagcacgttgaccgctatctgctggat
aacggcgccggcggcaccggccagcgtttcgactggtcggtattgcacggccaaaacctg
ggtaacgtgatgctggcgggcggtctgagcgcagacaactgcgttgacgcagccaaactc
ggctgtgccgggttggactttaactccggcgtcgagagccagcccggaattaaagatcct
gcccgcctggcggcggtatttcaaacgctgcgcgcctactga

DBGET integrated database retrieval system