KEGG   Serratia sp. AS12: SerAS12_3344Help
Entry
SerAS12_3344      CDS       T01502                                 

Definition
(GenBank) amidohydrolase
  KO
K01451  hippurate hydrolase [EC:3.5.1.32]
Organism
srs  Serratia sp. AS12
Pathway
srs00360  Phenylalanine metabolism
srs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SerAS12_3344
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:srs01002]
    SerAS12_3344
Enzymes [BR:srs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     SerAS12_3344
Peptidases and inhibitors [BR:srs01002]
 Metallo peptidases
  Family M20
   SerAS12_3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEF51405
Position
3564900..3566069
Genome map
AA seq 389 aa AA seqDB search
MPNPLVLPEIAAVKHEMVAIRRHIHAHPELGFNEFATSDLVAKLLAEWGYRITRHVGQTG
VVATLQRGTGKSLGLRADMDALPIEEATGLPYASTHNGVMHACGHDGHTTMLLAAARYLA
QHPSFIGTLHLIFQPAEEGGGGARVMIEDGLFDRFPCDAVFAMHNVPGFPVGQLGFASGP
FMCSADTVTITLHGQGGHGAVPQHTVDPVVVCAAIVMSLQTIVSRNIDPQETAIITVGAI
NAGKAANVIPASAQMTLSVRALDAGVRQRLESRITALVTAQAASFGATADIDYQHGYPVL
VNHVAETELARSVAEEWAGESRVIRQMRPITASEDFAFMLEKCPGSYISIGNGESTPGNA
LHNAGYDFNDECLPIGATYWVKLVERFLA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacccgcttgttttacctgaaatagccgctgttaagcacgaaatggtcgccatt
cgccgccatattcacgcacatcccgaattgggcttcaacgagttcgctaccagcgatctg
gtggcgaaactgctggccgaatggggttatcggattacgcgtcatgtaggacaaaccggt
gttgtcgccacgctgcaacgcggcacggggaaatcgctcggcttgcgtgccgacatggac
gcactgccgatcgaagaagccaccgggttgccctatgccagcacccataacggcgtgatg
cacgcctgcggtcatgacggccacaccaccatgctgctggcggcggcgcgctatctggca
cagcacccttcgtttatcggcaccctgcacctgattttccagccggcggaagaaggcggc
ggcggcgcccgagtgatgattgaagacgggctgttcgatcgcttcccttgtgatgccgtg
ttcgccatgcataacgttcccggcttcccggtcggccaactgggttttgccagcggcccc
ttcatgtgctcggccgatacggtcaccattaccctgcacggccagggcggccacggcgca
gtgccgcagcacacggtcgatccggtggtagtgtgcgccgccatagtgatgagcctgcaa
accatcgtctcgcgcaatatcgatccgcaggagacggcgatcatcacggttggcgcgatc
aacgccggcaaggccgccaacgtgatccctgccagcgcccaaatgacgctaagcgtgcgc
gcactggatgccggagtgcgccaacggttggaaagccgcattaccgcgctggtcacggcc
caagccgccagctttggcgccacagcggacatcgactaccagcacggctacccggtgttg
gtgaatcatgtggcagaaaccgagctggcgcgttcagtcgcggaggaatgggccggcgaa
agccgggttatccgccaaatgaggccaattaccgccagcgaagattttgcttttatgctg
gaaaaatgccccggcagctatatctcaatcggcaacggtgaaagtacgcccggaaatgcg
ctgcataacgccggttacgattttaacgatgagtgcctgcccattggcgccacttactgg
gtcaagctggttgagcgctttttggcttaa

DBGET integrated database retrieval system